![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pavir.9KG622300.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
Family | YABBY | ||||||||
Protein Properties | Length: 198aa MW: 22125.5 Da PI: 8.7686 | ||||||||
Description | YABBY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | YABBY | 51.1 | 5.3e-16 | 1 | 48 | 1 | 46 |
YABBY 1 advfssseqvCyvqCnfCntila..vsvPstslfkvvtvrCGhCtsll 46 +d++s+se++Cyv+C++Cnt+la v vP + l+ +vtv+CGhC +l Pavir.9KG622300.1.p 1 MDLVSQSEHLCYVRCTYCNTVLAlqVGVPCKRLMDTVTVKCGHCNNLS 48 57899****************9744778*****************984 PP | |||||||
2 | YABBY | 94.1 | 3.5e-29 | 82 | 149 | 95 | 162 |
YABBY 95 svsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWah 162 ++++ s ++e +pr+p v++PPek+ r Psaynrf++eeiqrika+ Pdi hreafs+aaknWa Pavir.9KG622300.1.p 82 NQPMPLASPTSTEASPRMPFVVKPPEKKHRLPSAYNRFMREEIQRIKAAKPDIPHREAFSMAAKNWAK 149 44555557889999*****************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04690 | 1.0E-44 | 6 | 150 | IPR006780 | YABBY protein |
SuperFamily | SSF47095 | 1.57E-8 | 92 | 151 | IPR009071 | High mobility group box domain |
Gene3D | G3DSA:1.10.30.10 | 1.9E-5 | 104 | 151 | IPR009071 | High mobility group box domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0010254 | Biological Process | nectary development | ||||
GO:0010582 | Biological Process | floral meristem determinacy | ||||
GO:0048479 | Biological Process | style development |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 198 aa Download sequence Send to blast |
MDLVSQSEHL CYVRCTYCNT VLALQVGVPC KRLMDTVTVK CGHCNNLSYL SPRPPMVQPL 60 SPTDHPLGPF QCQGPCNDCR RNQPMPLASP TSTEASPRMP FVVKPPEKKH RLPSAYNRFM 120 REEIQRIKAA KPDIPHREAF SMAAKNWAKC DPRCSTTVST ATSNSAPESR VVPAPQERAK 180 EQVIESFDIF KQIERSI* |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Detected during flower and leaf development. Expression in the flower meristem in the early stage of flower development. When carpel primordia begin to form, specific and uniform expression in carpel primordia. Expression in the central region of the leaf plastochron 1 (P1) primordia. Detected up to P4 stage, hardly detected in the P5 leaves. {ECO:0000269|PubMed:14729915}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Regulates carpel specification in flower development. Severe or intermediate mutation in DL causes complete or partial homeotic conversion of carpels into stamens without affecting the identities of other floral organs. Interacts antagonistically with class B genes and controls floral meristem determinacy. Regulates midrib formation in leaves probably by inducing cell proliferation in the central region of the leaf. {ECO:0000269|PubMed:14729915}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00220 | DAP | Transfer from AT1G69180 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pavir.9KG622300.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AB470268 | 0.0 | AB470268.1 Sorghum bicolor SbDL mRNA for DL related protein, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025797472.1 | 1e-142 | protein DROOPING LEAF isoform X1 | ||||
Swissprot | Q76EJ0 | 1e-115 | YABDL_ORYSJ; Protein DROOPING LEAF | ||||
TrEMBL | A0A2T7CFS9 | 1e-141 | A0A2T7CFS9_9POAL; Uncharacterized protein | ||||
TrEMBL | A0A2T8I5V1 | 1e-141 | A0A2T8I5V1_9POAL; Uncharacterized protein | ||||
STRING | Pavir.Ia04690.1.p | 1e-141 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP5951 | 36 | 57 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G69180.1 | 4e-50 | YABBY family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Pavir.9KG622300.1.p |