PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pavir.8KG323200.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 181aa MW: 19153.7 Da PI: 10.4404 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 123.2 | 8.9e-39 | 37 | 97 | 3 | 63 |
zf-Dof 3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 +a++cprC+stntkfCyynny+lsqPr+fC+aCrryWt GGalrn+PvGgg+r+ k+sss Pavir.8KG323200.1.p 37 AEAVRCPRCESTNTKFCYYNNYNLSQPRHFCRACRRYWTMGGALRNIPVGGGCRRAKRSSS 97 6789****************************************************99875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF02701 | 4.9E-33 | 39 | 94 | IPR003851 | Zinc finger, Dof-type |
ProDom | PD007478 | 4.0E-25 | 40 | 94 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 29.106 | 40 | 94 | IPR003851 | Zinc finger, Dof-type |
PROSITE pattern | PS01361 | 0 | 42 | 78 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 181 aa Download sequence Send to blast |
MQELRSIPGL DGQPFHVAGA PSGLRRAQAA QYQRKAAEAV RCPRCESTNT KFCYYNNYNL 60 SQPRHFCRAC RRYWTMGGAL RNIPVGGGCR RAKRSSSTDA KNPRSNSGST TMTAATATAP 120 ATPSSNSNTA VHVAPPAPIF ADQAAVLASL FPPPPLPLFS FTAMDKVAAS ALLAESNPPT 180 * |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Pvr.7271 | 4e-69 | callus |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed in germinating seeds up to 5 days after imbibition. {ECO:0000269|PubMed:11470159}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that may transactivate seed storage protein genes in developing seeds. {ECO:0000250|UniProtKB:Q6K537}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pavir.8KG323200.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by gibberellin. {ECO:0000269|PubMed:11470159}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AY955493 | 9e-70 | AY955493.2 Triticum aestivum Dof1 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025822624.1 | 4e-51 | dof zinc finger protein 4-like | ||||
Swissprot | Q6Z345 | 4e-44 | DOF4_ORYSJ; Dof zinc finger protein 4 | ||||
TrEMBL | A0A2S3GST5 | 9e-50 | A0A2S3GST5_9POAL; Uncharacterized protein | ||||
STRING | Pavir.J33457.1.p | 1e-127 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP6496 | 30 | 50 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G60200.1 | 8e-34 | TARGET OF MONOPTEROS 6 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Pavir.8KG323200.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|