PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum

Family

MYB

Protein Properties

Length: 262aa MW: 29276.9 Da PI: 6.7633

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Pavir.6KG400000.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	51.8	1.9e-16	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT+eEd++l+ + +G +W+++++ g+ R++k+c++rw +yl Pavir.6KG400000.1.p 14 RGPWTAEEDKKLISFILTHGRCCWRAVPKLAGLLRCGKSCRLRWTNYL 61 89****************************99**********97 PP
2	Myb_DNA-binding	53.6	5.2e-17	70	111	4	47
S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +t E++l +d++++lG++ W++Ia++++ gRt++++k++w+++ Pavir.6KG400000.1.p 70 LSTAEEQLVIDLHAKLGNR-WSKIAAKLP-GRTDNEIKNHWNTH 111 5899*************.*****.**********97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	5.2E-22	5	62	IPR009057	Homeodomain-like
PROSITE profile	PS51294	14.274	9	61	IPR017930	Myb domain
SuperFamily	SSF46689	4.49E-27	11	108	IPR009057	Homeodomain-like
SMART	SM00717	4.2E-13	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	2.9E-15	14	61	IPR001005	SANT/Myb domain
CDD	cd00167	5.86E-10	16	61	No hit	No description
PROSITE profile	PS51294	27.181	62	116	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	8.2E-25	63	117	IPR009057	Homeodomain-like
SMART	SM00717	7.9E-15	66	114	IPR001005	SANT/Myb domain
CDD	cd00167	2.96E-11	71	112	No hit	No description
Pfam	PF00249	8.6E-15	71	111	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 262 aa Download sequence Send to blast
MGRQPCCDKQ GVKRGPWTAE EDKKLISFIL THGRCCWRAV PKLAGLLRCG KSCRLRWTNY 60 LRPDLKRGLL STAEEQLVID LHAKLGNRWS KIAAKLPGRT DNEIKNHWNT HIKKKLIKMG 120 IDPATHQPLA NCKASTSQST DTAESTKSSD TRDEQGVKEG RRRDMALPTD SSEQSSWLES 180 GNKASGQDHE QLVNWLSETD LPMDEPWLNF TSTNDDALCT VEEPLPWDGA TDWLLDYQDF 240 SMCSSNLIGN STLPSSDGSN F*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	2e-27	14	116	7	108	B-MYB
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Pvr.16395	0.0	stem

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed in mature flowers and decreases upon pollination. {ECO:0000269\|PubMed:15805488}.
Uniprot	TISSUE SPECIFICITY: Restricted to the petals, with the highest expression in the limb. {ECO:0000269\|PubMed:15805488}.

Functional Description ? help Back to Top
Source	Description
UniProt	R2R3 MYB-type transcription factor controlling the production of volatile benzoides in flowers by regulating the shikimate pathway, namely by activation of the 5-enol-pyruvylshikimate-3-phosphate synthase gene. This scent, mostly produced in the evening and night by the petals, attracts the pollinators. Anthocyanins production is not controlled by ODO1 as color and scent are produced at different stages of development. {ECO:0000269\|PubMed:15805488}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Pavir.6KG400000.1.p

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Increases before the onset of volatile emission at the end of the light period, peaks at night and decreases when volatile emission declines early morning.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT068410	1e-143	BT068410.1 Zea mays full-length cDNA clone ZM_BFb0166A10 mRNA, complete cds.
GenBank	KJ727645	1e-143	KJ727645.1 Zea mays clone pUT5572 MYB transcription factor (MYB167) mRNA, partial cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_025820510.1	1e-180	protein ODORANT1-like
Refseq	XP_025820511.1	1e-180	protein ODORANT1-like
Refseq	XP_025820512.1	1e-180	protein ODORANT1-like
Refseq	XP_025820514.1	1e-180	protein ODORANT1-like
Refseq	XP_025820515.1	1e-180	protein ODORANT1-like
Refseq	XP_025820516.1	1e-180	protein ODORANT1-like
Refseq	XP_025820517.1	1e-180	protein ODORANT1-like
Refseq	XP_025820518.1	1e-180	protein ODORANT1-like
Refseq	XP_025820519.1	1e-180	protein ODORANT1-like
Refseq	XP_025820520.1	1e-180	protein ODORANT1-like
Refseq	XP_025820521.1	1e-180	protein ODORANT1-like
Refseq	XP_025820522.1	1e-180	protein ODORANT1-like
Refseq	XP_025820523.1	1e-180	protein ODORANT1-like
Swissprot	Q50EX6	4e-87	ODO1_PETHY; Protein ODORANT1
TrEMBL	A0A2T7DAG8	1e-179	A0A2T7DAG8_9POAL; Uncharacterized protein
STRING	Pavir.J36915.1.p	0.0	(Panicum virgatum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP79	38	563

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G12350.1	6e-86	myb domain protein 42

Link Out ? help Back to Top
Phytozome	Pavir.6KG400000.1.p

Publications ? help Back to Top
Verdonk JC,Haring MA,van Tunen AJ,Schuurink RC ODORANT1 regulates fragrance biosynthesis in petunia flowers. Plant Cell, 2005. 17(5): p. 1612-24 [PMID:15805488]