PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum

Family

ZF-HD

Protein Properties

Length: 91aa MW: 9620.69 Da PI: 7.8171

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Pavir.3NG303800.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	104.6	6.2e-33	24	80	2	59
ZF-HD_dimer 2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 + v+Y+eC++NhAa++Gg+avDGC+Efm+s g+egtaaal CaACgCHR+FHRreve Pavir.3NG303800.1.p 24 KVVHYRECQRNHAAAIGGYAVDGCREFMAS-GAEGTAAALMCAACGCHRSFHRREVEP 80 5799***********************9.999******************9875 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD125774	1.0E-21	24	89	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	3.0E-30	26	78	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	2.9E-26	27	78	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	26.258	28	77	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 91 aa Download sequence Send to blast
MGPQQDRRSM AANGTAARKE TNNKVVHYRE CQRNHAAAIG GYAVDGCREF MASGAEGTAA 60 ALMCAACGCH RSFHRREVEP DLDCSSTTSA *

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Pvr.30959	1e-149	root

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}.
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Pavir.3NG303800.1.p

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	EU976010	2e-60	EU976010.1 Zea mays clone 508548 zinc finger homeodomain protein 1 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_025808589.1	6e-53	mini zinc finger protein 1-like
Refseq	XP_025827869.1	6e-53	mini zinc finger protein 1-like
Swissprot	B8BIU8	4e-33	MIF1_ORYSI; Mini zinc finger protein 1
Swissprot	Q2RB28	4e-33	MIF1_ORYSJ; Mini zinc finger protein 1
TrEMBL	A0A270R7F7	1e-51	A0A270R7F7_9POAL; Uncharacterized protein
STRING	Pavir.J10145.1.p	1e-60	(Panicum virgatum)
STRING	Pavir.J19599.1.p	1e-60	(Panicum virgatum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP1431	34	120

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G28917.1	2e-30	mini zinc finger 2

Link Out ? help Back to Top
Phytozome	Pavir.3NG303800.1.p

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764]