![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pavir.3NG246100.3.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 176aa MW: 19678 Da PI: 5.2856 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 50.9 | 3.7e-16 | 2 | 43 | 5 | 48 |
-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 5 TteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 ++ E+ l++++++++G++ W++Iar+++ gRt++++k++w++++ Pavir.3NG246100.3.p 2 SPHEERLILELHARWGNR-WSRIARRLP-GRTDNEIKNYWRTHM 43 899***************.*********.************986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
CDD | cd00167 | 9.66E-13 | 1 | 43 | No hit | No description |
SMART | SM00717 | 3.8E-11 | 1 | 45 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 23.752 | 1 | 47 | IPR017930 | Myb domain |
Pfam | PF00249 | 3.9E-14 | 2 | 42 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 1.72E-12 | 2 | 49 | IPR009057 | Homeodomain-like |
Gene3D | G3DSA:1.10.10.60 | 1.2E-19 | 2 | 44 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009723 | Biological Process | response to ethylene | ||||
GO:0009739 | Biological Process | response to gibberellin | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0009753 | Biological Process | response to jasmonic acid | ||||
GO:0010200 | Biological Process | response to chitin | ||||
GO:0046686 | Biological Process | response to cadmium ion | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 176 aa Download sequence Send to blast |
MSPHEERLIL ELHARWGNRW SRIARRLPGR TDNEIKNYWR THMRKKAQER KRNMSPSSSS 60 SSLTYQSCYP DTPSTIGVEG QELHGGSGCI TSILKGNPSD MDGYPMDQIW MEIEAPEVPS 120 GMGLDGGNDN ACSSLATPLL PPTVWDYYSE ACWKMDEETK MAPQFGYNEG VGPSF* |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Pvr.8607 | 0.0 | callus| leaf |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. {ECO:0000305}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00600 | PBM | Transfer from AT5G59780 | Download |
![]() |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pavir.3NG246100.3.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT039131 | 0.0 | BT039131.1 Zea mays full-length cDNA clone ZM_BFb0374B19 mRNA, complete cds. | |||
GenBank | BT068640 | 0.0 | BT068640.1 Zea mays full-length cDNA clone ZM_BFb0353K20 mRNA, complete cds. | |||
GenBank | HQ858675 | 0.0 | HQ858675.1 Zea mays clone UT1131 MYB transcription factor mRNA, partial cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025808845.1 | 1e-116 | myb-related protein MYBAS2-like | ||||
Swissprot | Q4JL76 | 5e-83 | MYBA2_ORYSJ; Myb-related protein MYBAS2 | ||||
TrEMBL | A0A3L6T0P2 | 1e-117 | A0A3L6T0P2_PANMI; Myb-related protein MYBAS2-like | ||||
STRING | Pavir.J11500.1.p | 1e-128 | (Panicum virgatum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G59780.1 | 1e-34 | myb domain protein 59 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Pavir.3NG246100.3.p |
Publications ? help Back to Top | |||
---|---|---|---|
|