PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pavir.3KG126900.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 146aa MW: 16117.1 Da PI: 10.2721 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 48.7 | 1.6e-15 | 26 | 85 | 4 | 63 |
XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 ++ +r+ +NRe+ArrsR+RK++++eeL +v+ L+aeN + ++++ + e +k++ e+ Pavir.3KG126900.1.p 26 ERKRKRMLSNRESARRSRARKQQRLEELVAEVARLQAENVQVQSRIATFDREFSKVDGEN 85 46789999***************************************9999999888776 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00338 | 2.6E-19 | 23 | 87 | IPR004827 | Basic-leucine zipper domain |
Gene3D | G3DSA:1.20.5.170 | 1.4E-12 | 25 | 80 | No hit | No description |
PROSITE profile | PS50217 | 11.921 | 25 | 88 | IPR004827 | Basic-leucine zipper domain |
SuperFamily | SSF57959 | 3.88E-11 | 27 | 79 | No hit | No description |
Pfam | PF00170 | 8.3E-12 | 27 | 82 | IPR004827 | Basic-leucine zipper domain |
PROSITE pattern | PS00036 | 0 | 30 | 45 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 146 aa Download sequence Send to blast |
MSSRRSSSPE SNTDSGSGGG GFAADERKRK RMLSNRESAR RSRARKQQRL EELVAEVARL 60 QAENVQVQSR IATFDREFSK VDGENTVLRA RHGELAGRLE SLGSVLEVLQ MAGAPVDIPE 120 IPDPLLRPWQ PPFPMQPITA DAFQF* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 39 | 46 | RRSRARKQ |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Pvr.1847 | 0.0 | callus| root| stem |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Pavir.3KG126900.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025807736.1 | 3e-82 | bZIP transcription factor 53-like | ||||
TrEMBL | A0A2S3H7P6 | 6e-81 | A0A2S3H7P6_9POAL; Uncharacterized protein | ||||
TrEMBL | A0A2T7E7P9 | 6e-81 | A0A2T7E7P9_9POAL; Uncharacterized protein | ||||
STRING | Pavir.Ca00746.1.p | 2e-98 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1886 | 35 | 100 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G62420.1 | 6e-29 | basic region/leucine zipper motif 53 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Pavir.3KG126900.1.p |