 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
Pavir.1NG467300.1.p |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
Family |
NF-YB |
Protein Properties |
Length: 120aa MW: 12508.5 Da PI: 11.0954 |
Description |
NF-YB family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
Pavir.1NG467300.1.p | genome | JGI | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | NF-YB | 67.4 | 2.7e-21 | 62 | 118 | 7 | 63 |
NF-YB 7 flPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktin 63
lP+an++r+m++v+P+ k+s ak+++++c +ef++fv++eas+k+q+++r+ i+
Pavir.1NG467300.1.p 62 GLPMANLVRLMRQVIPKGVKVSARAKHLTHDCTVEFVGFVAGEASEKAQAQHRRIIS 118
69****************************************************986 PP
|
Expression --
Description ? help
Back to Top |
Source |
Description |
Uniprot | TISSUE SPECIFICITY: Expressed in developing kernels. {ECO:0000269|PubMed:11971906}. |
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. May act through association with MADS-box proteins. May regulate the expression of genes involved in flowering. {ECO:0000269|PubMed:11971906}. |
Annotation --
Nucleotide ? help
Back to Top |
Source |
Hit ID |
E-value |
Description |
GenBank | AC243257 | 1e-101 | AC243257.1 Panicum virgatum clone PV_ABa103-H05, complete sequence. |