PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Pahal.E00705.1

Organism

Panicum hallii

Taxonomic ID

206008

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum

Family

NAC

Protein Properties

Length: 300aa MW: 32739.3 Da PI: 8.4345

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Pahal.E00705.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	164.3	4.5e-51	10	134	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 lppGfrFhPtdeelv++yL+++++g ++ + +i+e+d+yk++Pw+Lp+ ++ +ekewyfFs+rd+ky++g+r+nra+ sgyWkatg dk+v + Pahal.E00705.1 10 LPPGFRFHPTDEELVMHYLCRRCAGLPIAV-PIIAEIDLYKFDPWQLPSLAQYGEKEWYFFSPRDRKYPNGSRPNRAAGSGYWKATGADKPVGT- 102 79************************99.88***********8888899*********************************99. PP NAM 96 kgelvglkktLvfykgrapkgektdWvmheyrl 128 + +kk Lvfy g+apkgekt+W+mheyrl Pahal.E00705.1 103 -PKPLAIKKALVFYAGKAPKGEKTNWIMHEYRL 134 .7789************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	6.54E-61	8	160	IPR003441	NAC domain
PROSITE profile	PS51005	59.639	10	160	IPR003441	NAC domain
Pfam	PF02365	3.6E-26	11	134	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009611	Biological Process	response to wounding
GO:0009788	Biological Process	negative regulation of abscisic acid-activated signaling pathway
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 300 aa Download sequence Send to blast
MSGGGQDLQL PPGFRFHPTD EELVMHYLCR RCAGLPIAVP IIAEIDLYKF DPWQLPSLAQ 60 YGEKEWYFFS PRDRKYPNGS RPNRAAGSGY WKATGADKPV GTPKPLAIKK ALVFYAGKAP 120 KGEKTNWIMH EYRLADVDRT ARKKNSLRLD DWVLCRIYNK KGGLEKPPVA AGDRKPALAA 180 GPAAVGSPPE QKPFVAAPGG LPPAFADLAA YYDRPSDSMP RLHADSSCSE QVLSPEQQFA 240 CDREVQSQPK ISEWERTFAS DPVNPAGSML DPTGHGGAGA GLGGDPLLQD ILMYWGKPF*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	8e-78	7	166	12	174	Stress-induced transcription factor NAC1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to the promoter of the stress response gene LEA19. Involved in tolerance to abiotic stresses (PubMed:20632034). Transcription activator involved in response to abiotic and biotic stresses. Involved in drought and salt stress responses, and defense response to the rice blast fungus (PubMed:17587305). Transcription activator involved tolerance to cold and salt stresses (PubMed:18273684). Transcription activator involved in tolerance to drought stress. Targets directly and activates genes involved in membrane modification, nicotianamine (NA) biosynthesis, glutathione relocation, accumulation of phosphoadenosine phosphosulfate and glycosylation in roots (PubMed:27892643). Controls root growth at early vegetative stage through chromatin modification and histone lysine deacytaltion by HDAC1 (PubMed:19453457). {ECO:0000269\|PubMed:17587305, ECO:0000269\|PubMed:18273684, ECO:0000269\|PubMed:19453457, ECO:0000269\|PubMed:20632034, ECO:0000269\|PubMed:27892643}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00121	DAP	Transfer from AT1G01720	Download

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by drought stress, salt stress, cold stress and abscisic acid (ABA) (PubMed:20632034, PubMed:27892643). Induced by methyl jasmonate (PubMed:20632034, PubMed:11332734). Induced by infection with the rice blast fungus Magnaporthe oryzae (PubMed:11332734). {ECO:0000269\|PubMed:11332734, ECO:0000269\|PubMed:20632034, ECO:0000269\|PubMed:27892643}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AY742218	0.0	AY742218.1 Saccharum officinarum NAC23 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_025814852.1	0.0	NAC domain-containing protein 48
Swissprot	Q7F2L3	1e-171	NAC48_ORYSJ; NAC domain-containing protein 48
TrEMBL	A0A2S3HPA8	0.0	A0A2S3HPA8_9POAL; Uncharacterized protein
TrEMBL	A0A2T7DDJ3	0.0	A0A2T7DDJ3_9POAL; Uncharacterized protein
STRING	Pavir.Ea03621.1.p	0.0	(Panicum virgatum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP3417	37	82

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G01720.1	1e-119	NAC family protein

Link Out ? help Back to Top
Phytozome	Pahal.E00705.1

Publications ? help Back to Top
Xiong L,Lee MW,Qi M,Yang Y Identification of defense-related rice genes by suppression subtractive hybridization and differential screening. Mol. Plant Microbe Interact., 2001. 14(5): p. 685-92 [PMID:11332734] Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Ohnishi T, et al. OsNAC6, a member of the NAC gene family, is induced by various stresses in rice. Genes Genet. Syst., 2005. 80(2): p. 135-9 [PMID:16172526] Hu H, et al. Characterization of transcription factor gene SNAC2 conferring cold and salt tolerance in rice. Plant Mol. Biol., 2008. 67(1-2): p. 169-81 [PMID:18273684] Kim MJ, et al. Quadruple 9-mer-based protein binding microarray with DsRed fusion protein. BMC Mol. Biol., 2009. 10: p. 91 [PMID:19761621] Chung PJ,Kim JK Epigenetic interaction of OsHDAC1 with the OsNAC6 gene promoter regulates rice root growth. Plant Signal Behav, 2009. 4(7): p. 675-7 [PMID:19820307] Peng HF, et al. Fine mapping of a gene for non-pollen type thermosensitive genic male sterility in rice (Oryza sativa L.). Theor. Appl. Genet., 2010. 120(5): p. 1013-20 [PMID:20012261] Takasaki H, et al. The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol. Genet. Genomics, 2010. 284(3): p. 173-83 [PMID:20632034] Kim MJ, et al. Convenient determination of protein-binding DNA sequences using quadruple 9-mer-based microarray and DsRed-monomer fusion protein. Methods Mol. Biol., 2012. 786: p. 65-77 [PMID:21938620] Gupta SK, et al. The single functional blast resistance gene Pi54 activates a complex defence mechanism in rice. J. Exp. Bot., 2012. 63(2): p. 757-72 [PMID:22058403] Nakashima K, et al. Comparative functional analysis of six drought-responsive promoters in transgenic rice. Planta, 2014. 239(1): p. 47-60 [PMID:24062085] Todaka D,Nakashima K,Shinozaki K,Yamaguchi-Shinozaki K Toward understanding transcriptional regulatory networks in abiotic stress responses and tolerance in rice. Rice (N Y), 2012. 5(1): p. 6 [PMID:24764506] Qian B, et al. Enhanced drought tolerance in transgenic rice over-expressing of maize C4 phosphoenolpyruvate carboxylase gene via NO and Ca(2+). J. Plant Physiol., 2015. 175: p. 9-20 [PMID:25460871] Shiriga K, et al. Genome-wide identification and expression pattern of drought-responsive members of the NAC family in maize. Meta Gene, 2014. 2: p. 407-17 [PMID:25606426] Farooq MA,Detterbeck A,Clemens S,Dietz KJ Silicon-induced reversibility of cadmium toxicity in rice. J. Exp. Bot., 2016. 67(11): p. 3573-85 [PMID:27122572] Lee DK, et al. The rice OsNAC6 transcription factor orchestrates multiple molecular mechanisms involving root structural adaptions and nicotianamine biosynthesis for drought tolerance. Plant Biotechnol. J., 2017. 15(6): p. 754-764 [PMID:27892643]