 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
Pahal.C00255.1 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
Family |
ZF-HD |
Protein Properties |
Length: 91aa MW: 9636.72 Da PI: 8.3893 |
Description |
ZF-HD family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
Pahal.C00255.1 | genome | JGI | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | ZF-HD_dimer | 103.4 | 1.4e-32 | 23 | 79 | 2 | 59 |
ZF-HD_dimer 2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59
+ v+Y+eC++NhAa++Gg+avDGC+Efm+s g+egtaaal CaACgCHR+FHRreve
Pahal.C00255.1 23 KVVHYRECQRNHAAAIGGYAVDGCREFMAS-GAEGTAAALMCAACGCHRSFHRREVEA 79
5799*************************9.999*********************976 PP
|
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}. |
UniProt | Inhibits zinc finger homeodomain (ZHD) transcription factors, by interacting with them to prevent both their nuclear localization and their DNA-binding properties. {ECO:0000250}. |
Annotation --
Nucleotide ? help
Back to Top |
Source |
Hit ID |
E-value |
Description |
GenBank | EU976010 | 4e-58 | EU976010.1 Zea mays clone 508548 zinc finger homeodomain protein 1 mRNA, complete cds. |