PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pahal.B04035.3 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 135aa MW: 13346.8 Da PI: 9.9591 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 70.7 | 2.7e-22 | 86 | 133 | 1 | 48 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSS CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsr 48 +Cq+e+C+adl+ea +y+rrhkvC++hskapvvlv+gl+qrfCqqCsr Pahal.B04035.3 86 RCQAERCNADLNEAGQYNRRHKVCQTHSKAPVVLVAGLRQRFCQQCSR 133 6**********************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 6.7E-23 | 82 | 133 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 19.05 | 84 | 134 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 2.35E-21 | 85 | 133 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 7.5E-17 | 87 | 133 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009911 | Biological Process | positive regulation of flower development | ||||
GO:0010228 | Biological Process | vegetative to reproductive phase transition of meristem | ||||
GO:0010229 | Biological Process | inflorescence development | ||||
GO:0010321 | Biological Process | regulation of vegetative phase change | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 135 aa Download sequence Send to blast |
MDRKDKSRRG SSSSAAAAAS MAALAAAAAA GEGSSSGSGS ADGALPPLGE EEDQKPPKLA 60 AVAGASSSSP VPARRGAAAG AGGGPRCQAE RCNADLNEAG QYNRRHKVCQ THSKAPVVLV 120 AGLRQRFCQQ CSRA* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 4e-18 | 78 | 133 | 2 | 57 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00634 | PBM | Transfer from PK22320.1 | Download |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT065445 | 5e-55 | BT065445.2 Zea mays full-length cDNA clone ZM_BFb0161D05 mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025804566.1 | 3e-86 | squamosa promoter-binding-like protein 13 | ||||
TrEMBL | A0A2S3H2X7 | 2e-86 | A0A2S3H2X7_9POAL; Uncharacterized protein | ||||
STRING | Pavir.Bb02800.1.p | 6e-36 | (Panicum virgatum) | ||||
STRING | Si032170m | 2e-36 | (Setaria italica) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G02065.2 | 4e-19 | squamosa promoter binding protein-like 8 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Pahal.B04035.3 |