![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pahal.B01216.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 73aa MW: 8380.96 Da PI: 11.5856 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 52.9 | 5.1e-17 | 15 | 49 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 C++C++t T+lWR+gp g k+LCn CGl+yr+kgl Pahal.B01216.1 15 CTQCHATITSLWRSGPFGRKSLCNVCGLRYRRKGL 49 ********************************996 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF57716 | 1.43E-11 | 8 | 49 | No hit | No description |
PROSITE profile | PS50114 | 12.374 | 9 | 64 | IPR000679 | Zinc finger, GATA-type |
SMART | SM00401 | 1.4E-9 | 9 | 61 | IPR000679 | Zinc finger, GATA-type |
Gene3D | G3DSA:3.30.50.10 | 1.2E-13 | 14 | 49 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 8.70E-9 | 15 | 65 | No hit | No description |
Pfam | PF00320 | 7.5E-15 | 15 | 49 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 73 aa Download sequence Send to blast |
MKVVCSLNRN KLKMCTQCHA TITSLWRSGP FGRKSLCNVC GLRYRRKGLE GQELGRKKDR 60 GKNRRYINRV PL* |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015646409.1 | 2e-17 | GATA transcription factor 15 | ||||
TrEMBL | A2YJW2 | 4e-16 | A2YJW2_ORYSI; Uncharacterized protein | ||||
STRING | Pavir.Ba03329.1.p | 2e-30 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP18253 | 8 | 10 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G56860.1 | 4e-12 | GATA family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Pahal.B01216.1 |