![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Pahal.A02117.2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 205aa MW: 22630.1 Da PI: 5.804 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 107.7 | 1.4e-33 | 7 | 124 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 lppGf+F P+de+lvv++L++k+++ +++ ++i++v + +++Pw+L+ ++ + ++wyfFs++++ +r+ +gyW+ g d++v+s Pahal.A02117.2 7 LPPGFHFFPSDEDLVVHFLRRKAANLPCRP-DIIPTVLLQHYNPWELNGTALQAGNQWYFFSHAAQ--------SRISPNGYWNPIGADETVTS- 91 79*************************999.99**************965566789******9855........68999***************. PP NAM 96 kgelvglkktLvfykgrapkgektdWvmheyrl 128 +g vglkktL+f +g+ +kg kt+W+mhey+l Pahal.A02117.2 92 SGCIVGLKKTLIFCTGEPSKGFKTNWIMHEYHL 124 999*****************************8 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 9.29E-45 | 4 | 167 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 40.878 | 7 | 168 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.2E-20 | 8 | 124 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 205 aa Download sequence Send to blast |
MGGATDLPPG FHFFPSDEDL VVHFLRRKAA NLPCRPDIIP TVLLQHYNPW ELNGTALQAG 60 NQWYFFSHAA QSRISPNGYW NPIGADETVT SSGCIVGLKK TLIFCTGEPS KGFKTNWIMH 120 EYHLQDGGYN VSGSSTSSSS SSSRKSQRKR VHSSTESNNW VICRVFESSC GSQVSFHDEG 180 TELSCLDEVF LSLDDYDEVS LPNN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 2e-34 | 7 | 173 | 17 | 170 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 2e-34 | 7 | 173 | 17 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 2e-34 | 7 | 173 | 17 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 2e-34 | 7 | 173 | 17 | 170 | NO APICAL MERISTEM PROTEIN |
3swm_A | 2e-34 | 7 | 173 | 20 | 173 | NAC domain-containing protein 19 |
3swm_B | 2e-34 | 7 | 173 | 20 | 173 | NAC domain-containing protein 19 |
3swm_C | 2e-34 | 7 | 173 | 20 | 173 | NAC domain-containing protein 19 |
3swm_D | 2e-34 | 7 | 173 | 20 | 173 | NAC domain-containing protein 19 |
3swp_A | 2e-34 | 7 | 173 | 20 | 173 | NAC domain-containing protein 19 |
3swp_B | 2e-34 | 7 | 173 | 20 | 173 | NAC domain-containing protein 19 |
3swp_C | 2e-34 | 7 | 173 | 20 | 173 | NAC domain-containing protein 19 |
3swp_D | 2e-34 | 7 | 173 | 20 | 173 | NAC domain-containing protein 19 |
4dul_A | 2e-34 | 7 | 173 | 17 | 170 | NAC domain-containing protein 19 |
4dul_B | 2e-34 | 7 | 173 | 17 | 170 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025827936.1 | 1e-152 | NAC domain-containing protein 104-like | ||||
Swissprot | Q8GWK6 | 8e-61 | NC104_ARATH; NAC domain-containing protein 104 | ||||
TrEMBL | A0A2S3GPW1 | 1e-151 | A0A2S3GPW1_9POAL; Uncharacterized protein | ||||
TrEMBL | A0A2T7F7M2 | 1e-151 | A0A2T7F7M2_9POAL; Uncharacterized protein | ||||
STRING | Pavir.Aa01694.1.p | 1e-140 | (Panicum virgatum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64530.1 | 4e-61 | xylem NAC domain 1 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Pahal.A02117.2 |
Publications ? help Back to Top | |||
---|---|---|---|
|