PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pseudotsuga

Family

NAC

Protein Properties

Length: 194aa MW: 22007.7 Da PI: 10.1722

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PSME_00055048-RA	genome	PRS	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	162.5	1.5e-50	36	162	2	128
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 ppGf+F Pt eelvv+yL+kk +++ +++ +i+evd+yk++Pw+Lp k++ +ekewyfF+++d+ky++g+r++rat sgyWkatg dk++ + PSME_00055048-RA 36 PPGFKFFPTYEELVVHYLCKKEASQIIPV-PIIAEVDLYKYDPWQLPDKAQFGEKEWYFFTPHDRKYPNGSRPKRATGSGYWKATGVDKPINV 127 9**************************.88***********99999************************************* PP NAM 95 k.kgelvglkktLvfykgrapkgektdWvmheyrl 128 k +++ vg+kk Lvfy g+apkg+kt+W+mheyrl PSME_00055048-RA 128 KgGKKRVGIKKALVFYVGKAPKGSKTNWIMHEYRL 162 966777*************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	6.8E-55	30	164	IPR003441	NAC domain
PROSITE profile	PS51005	51.483	35	187	IPR003441	NAC domain
Pfam	PF02365	8.5E-25	36	162	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 194 aa Download sequence Send to blast
MGGIKGLGTI RVAIHLEELC KQAIDHCALL VHNQWPPGFK FFPTYEELVV HYLCKKEASQ 60 IIPVPIIAEV DLYKYDPWQL PDKAQFGEKE WYFFTPHDRK YPNGSRPKRA TGSGYWKATG 120 VDKPINVKGG KKRVGIKKAL VFYVGKAPKG SKTNWIMHEY RLADVSRPAR KKGSLRVSWS 180 ISSLLCFESA VLTT

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	2e-67	23	178	5	155	NO APICAL MERISTEM PROTEIN
1ut4_B	2e-67	23	178	5	155	NO APICAL MERISTEM PROTEIN
1ut7_A	2e-67	23	178	5	155	NO APICAL MERISTEM PROTEIN
1ut7_B	2e-67	23	178	5	155	NO APICAL MERISTEM PROTEIN
3swm_A	2e-67	23	178	8	158	NAC domain-containing protein 19
3swm_B	2e-67	23	178	8	158	NAC domain-containing protein 19
3swm_C	2e-67	23	178	8	158	NAC domain-containing protein 19
3swm_D	2e-67	23	178	8	158	NAC domain-containing protein 19
3swp_A	2e-67	23	178	8	158	NAC domain-containing protein 19
3swp_B	2e-67	23	178	8	158	NAC domain-containing protein 19
3swp_C	2e-67	23	178	8	158	NAC domain-containing protein 19
3swp_D	2e-67	23	178	8	158	NAC domain-containing protein 19
4dul_A	2e-67	23	178	5	155	NAC domain-containing protein 19
4dul_B	2e-67	23	178	5	155	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in stress response. {ECO:0000250\|UniProtKB:Q7F2L3}.
UniProt	Transcriptional activator that positively regulates age-dependent senescence, dark-induced leaf senescence and stress-induced senescence. Regulates leaf senescence through the modulation of the expression of senescence-associated genes SGR1/NYE1, SAG113 and SAUR36/SAG201, which are involved in chlorophyll degradation, and abscisic acid (ABA) and auxin promotion of senescence, respectively. Promotes reactive oxygen species (ROS) production during age-dependent and stress-induced senescence. Regulates positively auxin-mediated responses in roots (PubMed:27388337). Stress-responsive NAC transcription factor involved in ABA-inducible leaf senescence signaling (PubMed:26518251). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269\|PubMed:18849494, ECO:0000269\|PubMed:26518251, ECO:0000269\|PubMed:27388337}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By abscisic acid (ABA) (PubMed:26518251). Induced by salinity and osmotic stress, and during leaf senescence (PubMed:27388337). {ECO:0000269\|PubMed:26518251, ECO:0000269\|PubMed:27388337}.
UniProt	INDUCTION: Induced by salt stress (PubMed:18813954, PubMed:20632034). Induced by dehydration, cold stress and methyl jasmonate (PubMed:20632034). {ECO:0000269\|PubMed:18813954, ECO:0000269\|PubMed:20632034}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_008792530.1	2e-75	NAC domain-containing protein 2-like isoform X1
Refseq	XP_009394855.1	1e-75	PREDICTED: NAC domain-containing protein 68-like
Swissprot	Q52QH4	2e-72	NAC68_ORYSJ; NAC domain-containing protein 68
Swissprot	Q9CAR0	1e-72	NAC32_ARATH; NAC transcription factor 32
TrEMBL	A0A0D6R3P9	1e-85	A0A0D6R3P9_ARACU; Uncharacterized protein
STRING	XP_008792530.1	7e-75	(Phoenix dactylifera)
STRING	GSMUA_Achr4P02390_001	6e-75	(Musa acuminata)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G77450.1	5e-69	NAC domain containing protein 32

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Taga Y, et al. Role of OsHSP90 and IREN, Ca2+ dependent nuclease, in plant hypersensitive cell death induced by transcription factor OsNAC4. Plant Signal Behav, 2009. 4(8): p. 740-2 [PMID:19820348] Xia N, et al. Characterization of a novel wheat NAC transcription factor gene involved in defense response against stripe rust pathogen infection and abiotic stresses. Mol. Biol. Rep., 2010. 37(8): p. 3703-12 [PMID:20213512] Takasaki H, et al. The abiotic stress-responsive NAC-type transcription factor OsNAC5 regulates stress-inducible genes and stress tolerance in rice. Mol. Genet. Genomics, 2010. 284(3): p. 173-83 [PMID:20632034] Nakayama A, et al. Genome-wide identification of WRKY45-regulated genes that mediate benzothiadiazole-induced defense responses in rice. BMC Plant Biol., 2013. 13: p. 150 [PMID:24093634] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Vermeirssen V,De Clercq I,Van Parys T,Van Breusegem F,Van de Peer Y Arabidopsis ensemble reverse-engineered gene regulatory network discloses interconnected transcription factors in oxidative stress. Plant Cell, 2014. 26(12): p. 4656-79 [PMID:25549671] Takasaki H, et al. SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence. Plant J., 2015. 84(6): p. 1114-23 [PMID:26518251] Ootsubo Y,Hibino T,Wakazono T,Mukai Y,Che FS IREN, a novel EF-hand motif-containing nuclease, functions in the degradation of nuclear DNA during the hypersensitive response cell death in rice. Biosci. Biotechnol. Biochem., 2016. 80(4): p. 748-60 [PMID:26766411] Mahmood K,El-Kereamy A,Kim SH,Nambara E,Rothstein SJ ANAC032 Positively Regulates Age-Dependent and Stress-Induced Senescence in Arabidopsis thaliana. Plant Cell Physiol., 2016. 57(10): p. 2029-2046 [PMID:27388337] Allu AD,Brotman Y,Xue GP,Balazadeh S Transcription factor ANAC032 modulates JA/SA signalling in response to Pseudomonas syringae infection. EMBO Rep., 2016. 17(11): p. 1578-1589 [PMID:27632992] Mahmood K,Xu Z,El-Kereamy A,Casaretto JA,Rothstein SJ The Arabidopsis Transcription Factor ANAC032 Represses Anthocyanin Biosynthesis in Response to High Sucrose and Oxidative and Abiotic Stresses. Front Plant Sci, 2016. 7: p. 1548 [PMID:27790239] Song L, et al. A transcription factor hierarchy defines an environmental stress response network. Science, 2017. [PMID:27811239]