![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PK26618.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 196aa MW: 22746.5 Da PI: 9.5352 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 183.4 | 5.5e-57 | 6 | 133 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 lppGfrFhPtdeelv +yL +k++g+++el e+i+evd+yk+ePwdLp k + +++ ewyf+s+rd+ky++g+r+nrat++gyWkatgkd++v s +++ PK26618.1 6 LPPGFRFHPTDEELVAYYLDRKITGQTIEL-EIIPEVDLYKCEPWDLPeKsYLPSKDMEWYFYSPRDRKYPNGSRTNRATRAGYWKATGKDRAVQS-QRR 103 79****************************.99**************94345566888*************************************9.999 PP NAM 99 lvglkktLvfykgrapkgektdWvmheyrl 128 vg+kktLv+y+grap+g +t+Wvmheyrl PK26618.1 104 PVGMKKTLVYYRGRAPHGIRTNWVMHEYRL 133 ****************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.19E-64 | 3 | 158 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 60.845 | 6 | 158 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.3E-29 | 7 | 133 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0044212 | Molecular Function | transcription regulatory region DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 196 aa Download sequence Send to blast |
MAPMSLPPGF RFHPTDEELV AYYLDRKITG QTIELEIIPE VDLYKCEPWD LPEKSYLPSK 60 DMEWYFYSPR DRKYPNGSRT NRATRAGYWK ATGKDRAVQS QRRPVGMKKT LVYYRGRAPH 120 GIRTNWVMHE YRLLDDSLGG TVSSTLKDSY ALCRVFKKTI QIPKCNKNEE NPDNNNINGR 180 NNTEKDNQST ALGIIX |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 3e-59 | 1 | 158 | 12 | 165 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 3e-59 | 1 | 158 | 12 | 165 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 3e-59 | 1 | 158 | 12 | 165 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 3e-59 | 1 | 158 | 12 | 165 | NO APICAL MERISTEM PROTEIN |
3swm_A | 3e-59 | 1 | 158 | 15 | 168 | NAC domain-containing protein 19 |
3swm_B | 3e-59 | 1 | 158 | 15 | 168 | NAC domain-containing protein 19 |
3swm_C | 3e-59 | 1 | 158 | 15 | 168 | NAC domain-containing protein 19 |
3swm_D | 3e-59 | 1 | 158 | 15 | 168 | NAC domain-containing protein 19 |
3swp_A | 3e-59 | 1 | 158 | 15 | 168 | NAC domain-containing protein 19 |
3swp_B | 3e-59 | 1 | 158 | 15 | 168 | NAC domain-containing protein 19 |
3swp_C | 3e-59 | 1 | 158 | 15 | 168 | NAC domain-containing protein 19 |
3swp_D | 3e-59 | 1 | 158 | 15 | 168 | NAC domain-containing protein 19 |
4dul_A | 3e-59 | 1 | 158 | 12 | 165 | NAC domain-containing protein 19 |
4dul_B | 3e-59 | 1 | 158 | 12 | 165 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00205 | DAP | Transfer from AT1G54330 | Download |
![]() |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010092473.1 | 1e-119 | NAC domain-containing protein 86 | ||||
Swissprot | Q9FFI5 | 8e-87 | NAC86_ARATH; NAC domain-containing protein 86 | ||||
TrEMBL | A0A2P5CMM2 | 1e-122 | A0A2P5CMM2_TREOI; NAC domain containing protein | ||||
STRING | XP_010092473.1 | 1e-119 | (Morus notabilis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF10508 | 33 | 41 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G54330.1 | 4e-97 | NAC domain containing protein 20 |
Publications ? help Back to Top | |||
---|---|---|---|
|