PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PK26417.1

Organism

Cannabis sativa

Taxonomic ID

3483

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis

Family

HSF

Protein Properties

Length: 62aa MW: 7201.58 Da PI: 4.4169

Description

HSF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PK26417.1	genome	CCBR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	HSF_DNA-bind	51.5	2.9e-16	18	61	12	55
TGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHH CS HSF_DNA-bind 12 deelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvR 55 ++++ ++isw+e+g+ f+v+ + ef++ +LpkyFkh+nf+SF+R PK26417.1 18 NNNNGSIISWNEEGDGFIVWSPPEFSELLLPKYFKHNNFSSFIR 61 677889*************************************9 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46785	2.31E-13	17	61	IPR011991	Winged helix-turn-helix DNA-binding domain
Gene3D	G3DSA:1.10.10.10	2.6E-16	18	61	IPR011991	Winged helix-turn-helix DNA-binding domain
Pfam	PF00447	3.3E-13	18	61	IPR000232	Heat shock factor (HSF)-type, DNA-binding

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 62 aa Download sequence Send to blast
LELQERTRAV GSNDDHDNNN NGSIISWNEE GDGFIVWSPP EFSELLLPKY FKHNNFSSFI 60 RX

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}.
UniProt	Transcriptional regulator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE).

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By heat stress. {ECO:0000269\|PubMed:9645433}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018820155.1	2e-20	PREDICTED: heat stress transcription factor B-2a-like
Swissprot	Q652B0	6e-14	HFB2C_ORYSJ; Heat stress transcription factor B-2c
Swissprot	Q96320	3e-14	HSFB1_ARATH; Heat stress transcription factor B-1
TrEMBL	A0A2I4EL76	4e-19	A0A2I4EL76_JUGRE; heat stress transcription factor B-2a-like
STRING	XP_009352926.1	1e-18	(Pyrus x bretschneideri)
STRING	XP_006449329.1	1e-18	(Citrus clementina)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1592	33	95

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G11660.1	4e-16	HSF family protein

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Rerksiri W,Zhang X,Xiong H,Chen X Expression and promoter analysis of six heat stress-inducible genes in rice. ScientificWorldJournal, 2013. 2013: p. 397401 [PMID:24459431] Weng M, et al. Histone chaperone ASF1 is involved in gene transcription activation in response to heat stress in Arabidopsis thaliana. Plant Cell Environ., 2014. 37(9): p. 2128-38 [PMID:24548003] Nagashima Y,Iwata Y,Ashida M,Mishiba K,Koizumi N Exogenous salicylic acid activates two signaling arms of the unfolded protein response in Arabidopsis. Plant Cell Physiol., 2014. 55(10): p. 1772-8 [PMID:25138441] Nie S,Yue H,Xing D A Potential Role for Mitochondrial Produced Reactive Oxygen Species in Salicylic Acid-Mediated Plant Acquired Thermotolerance. Plant Physiol., 2016. [PMID:26099269] Hossain MA, et al. Identification of Novel Components of the Unfolded Protein Response in Arabidopsis. Front Plant Sci, 2016. 7: p. 650 [PMID:27242851] Röth S,Mirus O,Bublak D,Scharf KD,Schleiff E DNA-binding and repressor function are prerequisites for the turnover of the tomato heat stress transcription factor HsfB1. Plant J., 2017. 89(1): p. 31-44 [PMID:27560701] Xu G, et al. uORF-mediated translation allows engineered plant disease resistance without fitness costs. Nature, 2017. 545(7655): p. 491-494 [PMID:28514448]