 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
PK26417.1 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
| Family |
HSF |
| Protein Properties |
Length: 62aa MW: 7201.58 Da PI: 4.4169 |
| Description |
HSF family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| PK26417.1 | genome | CCBR | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | HSF_DNA-bind | 51.5 | 2.9e-16 | 18 | 61 | 12 | 55 |
TGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHH CS
HSF_DNA-bind 12 deelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvR 55
++++ ++isw+e+g+ f+v+ + ef++ +LpkyFkh+nf+SF+R
PK26417.1 18 NNNNGSIISWNEEGDGFIVWSPPEFSELLLPKYFKHNNFSSFIR 61
677889*************************************9 PP
|
| Gene Ontology ? help Back to Top |
| GO Term |
GO Category |
GO Description |
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
| GO:0005634 | Cellular Component | nucleus |
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
| GO:0043565 | Molecular Function | sequence-specific DNA binding |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}. |
| UniProt | Transcriptional regulator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). |
| Regulation -- Description ? help
Back to Top |
| Source |
Description |
| UniProt | INDUCTION: By heat stress. {ECO:0000269|PubMed:9645433}. |
| Publications
? help Back to Top |
- Kikuchi S, et al.
Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
Science, 2003. 301(5631): p. 376-9
[PMID:12869764] - Rerksiri W,Zhang X,Xiong H,Chen X
Expression and promoter analysis of six heat stress-inducible genes in rice.
ScientificWorldJournal, 2013. 2013: p. 397401
[PMID:24459431] - Weng M, et al.
Histone chaperone ASF1 is involved in gene transcription activation in response to heat stress in Arabidopsis thaliana.
Plant Cell Environ., 2014. 37(9): p. 2128-38
[PMID:24548003] - Nagashima Y,Iwata Y,Ashida M,Mishiba K,Koizumi N
Exogenous salicylic acid activates two signaling arms of the unfolded protein response in Arabidopsis.
Plant Cell Physiol., 2014. 55(10): p. 1772-8
[PMID:25138441] - Nie S,Yue H,Xing D
A Potential Role for Mitochondrial Produced Reactive Oxygen Species in Salicylic Acid-Mediated Plant Acquired Thermotolerance.
Plant Physiol., 2016.
[PMID:26099269] - Hossain MA, et al.
Identification of Novel Components of the Unfolded Protein Response in Arabidopsis.
Front Plant Sci, 2016. 7: p. 650
[PMID:27242851] - Röth S,Mirus O,Bublak D,Scharf KD,Schleiff E
DNA-binding and repressor function are prerequisites for the turnover of the tomato heat stress transcription factor HsfB1.
Plant J., 2017. 89(1): p. 31-44
[PMID:27560701] - Xu G, et al.
uORF-mediated translation allows engineered plant disease resistance without fitness costs.
Nature, 2017. 545(7655): p. 491-494
[PMID:28514448]
|
