 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
PK26008.1 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
| Family |
MYB |
| Protein Properties |
Length: 121aa MW: 13827 Da PI: 10.2819 |
| Description |
MYB family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| PK26008.1 | genome | CCBR | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | Myb_DNA-binding | 51.3 | 2.6e-16 | 14 | 62 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
+g+W++eEd +l+ ++ +G+g +W + ++++g++R++k+c++rw++yl
PK26008.1 14 KGPWSPEEDTKLKAYIDTYGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
79**********************************************7 PP
|
| 2 | Myb_DNA-binding | 40.1 | 8.6e-13 | 69 | 111 | 2 | 46 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
g +++eEd ++ + G++ W+ Ia+ ++ gRt++++k++w++
PK26008.1 69 GGFSEEEDNIICSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
569******************.*********.***********97 PP
|
| Gene Ontology ? help Back to Top |
| GO Term |
GO Category |
GO Description |
| GO:0008285 | Biological Process | negative regulation of cell proliferation |
| GO:0035987 | Biological Process | endodermal cell differentiation |
| GO:0045597 | Biological Process | positive regulation of cell differentiation |
| GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated |
| GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated |
| GO:2000021 | Biological Process | regulation of ion homeostasis |
| GO:2000067 | Biological Process | regulation of root morphogenesis |
| GO:0048226 | Cellular Component | Casparian strip |
| GO:0000975 | Molecular Function | regulatory region DNA binding |
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Transcription factors that activates genes required for endodermal differentiation but represses genes involved in proliferative divisions, thus regulating the transition from proliferation to differentiation in root endodermis (PubMed:26371322). Required for Casparian strip formation by positively regulating the expression of the Casparian strip genes CASP1, PER64 and ESB1 and other endodermis-specific genes, thus triggering correct localized lignin biosynthesis in root endodermis and subsequently regulating global ion homeostasis (PubMed:26124109, PubMed:26371322). {ECO:0000269|PubMed:26124109, ECO:0000269|PubMed:26371322}. |
| Regulation -- Description ? help
Back to Top |
| Source |
Description |
| UniProt | INDUCTION: Directly up-regulated by SCARECROW (SCR), as part of the differentiation program controlled by SHORT-ROOT (SHR). {ECO:0000269|PubMed:24517883, ECO:0000269|PubMed:26371322}. |
