PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PK23889.1

Organism

Cannabis sativa

Taxonomic ID

3483

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis

Family

WRKY

Protein Properties

Length: 131aa MW: 15274.2 Da PI: 9.6789

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PK23889.1	genome	CCBR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	94	1.1e-29	77	130	2	55
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES- CS WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYege 55 +Dgy+WrKYGqK vk+s++prsYYrCt+++C vkk+vers +dp++v++tYeg+ PK23889.1 77 EDGYRWRKYGQKAVKNSPYPRSYYRCTTQKCGVKKRVERSYQDPSTVITTYEGT 130 8***************************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	5.2E-31	61	130	IPR003657	WRKY domain
SuperFamily	SSF118290	2.88E-26	68	129	IPR003657	WRKY domain
PROSITE profile	PS50811	27.829	71	131	IPR003657	WRKY domain
SMART	SM00774	6.1E-30	76	131	IPR003657	WRKY domain
Pfam	PF03106	5.2E-23	77	130	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 131 aa Download sequence Send to blast
HDHDSSVHNH SNNRDQKRKG SEDQDHDDEE VDDSNSNKKV SKGNNNNKNG NSNKKGEKKQ 60 KEPRFAFMTK SEVDHLEDGY RWRKYGQKAV KNSPYPRSYY RCTTQKCGVK KRVERSYQDP 120 STVITTYEGT X

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	6e-28	66	129	7	70	Probable WRKY transcription factor 4
2lex_A	6e-28	66	129	7	70	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009353824.1	4e-50	PREDICTED: probable WRKY transcription factor 71
Refseq	XP_009360850.1	4e-50	PREDICTED: probable WRKY transcription factor 71
Refseq	XP_020267391.1	1e-50	probable WRKY transcription factor 71
Swissprot	Q8VWJ2	6e-44	WRK28_ARATH; WRKY transcription factor 28
TrEMBL	A0A2P5DL95	1e-56	A0A2P5DL95_TREOI; WRKY domain containing protein
STRING	XP_009353824.1	2e-49	(Pyrus x bretschneideri)
STRING	XP_009360850.1	2e-49	(Pyrus x bretschneideri)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF2231	34	83

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G29860.1	4e-42	WRKY DNA-binding protein 71

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Kim SH, et al. Characterization of a Novel DWD protein that participates in heat stress response in Arabidopsis. Mol. Cells, 2014. 37(11): p. 833-40 [PMID:25358503] Zhao L, et al. KLU suppresses megasporocyte cell fate through SWR1-mediated activation of WRKY28 expression in Arabidopsis. Proc. Natl. Acad. Sci. U.S.A., 2018. 115(3): p. E526-E535 [PMID:29288215]