![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PK23889.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 131aa MW: 15274.2 Da PI: 9.6789 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 94 | 1.1e-29 | 77 | 130 | 2 | 55 |
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES- CS WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYege 55 +Dgy+WrKYGqK vk+s++prsYYrCt+++C vkk+vers +dp++v++tYeg+ PK23889.1 77 EDGYRWRKYGQKAVKNSPYPRSYYRCTTQKCGVKKRVERSYQDPSTVITTYEGT 130 8***************************************************96 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 5.2E-31 | 61 | 130 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 2.88E-26 | 68 | 129 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 27.829 | 71 | 131 | IPR003657 | WRKY domain |
SMART | SM00774 | 6.1E-30 | 76 | 131 | IPR003657 | WRKY domain |
Pfam | PF03106 | 5.2E-23 | 77 | 130 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 131 aa Download sequence Send to blast |
HDHDSSVHNH SNNRDQKRKG SEDQDHDDEE VDDSNSNKKV SKGNNNNKNG NSNKKGEKKQ 60 KEPRFAFMTK SEVDHLEDGY RWRKYGQKAV KNSPYPRSYY RCTTQKCGVK KRVERSYQDP 120 STVITTYEGT X |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 6e-28 | 66 | 129 | 7 | 70 | Probable WRKY transcription factor 4 |
2lex_A | 6e-28 | 66 | 129 | 7 | 70 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_009353824.1 | 4e-50 | PREDICTED: probable WRKY transcription factor 71 | ||||
Refseq | XP_009360850.1 | 4e-50 | PREDICTED: probable WRKY transcription factor 71 | ||||
Refseq | XP_020267391.1 | 1e-50 | probable WRKY transcription factor 71 | ||||
Swissprot | Q8VWJ2 | 6e-44 | WRK28_ARATH; WRKY transcription factor 28 | ||||
TrEMBL | A0A2P5DL95 | 1e-56 | A0A2P5DL95_TREOI; WRKY domain containing protein | ||||
STRING | XP_009353824.1 | 2e-49 | (Pyrus x bretschneideri) | ||||
STRING | XP_009360850.1 | 2e-49 | (Pyrus x bretschneideri) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2231 | 34 | 83 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G29860.1 | 4e-42 | WRKY DNA-binding protein 71 |
Publications ? help Back to Top | |||
---|---|---|---|
|