PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PK21617.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 95aa MW: 10420.8 Da PI: 9.5457 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 62.6 | 9.9e-20 | 50 | 95 | 1 | 46 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkll 46 +CaaCk+lrr+Ca++C+++pyf ++p+kfa+vhk+FGasnv+k+l PK21617.1 50 PCAACKLLRRRCAEECPFSPYFSPQEPQKFAAVHKVFGASNVSKML 95 7*******************************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 16.804 | 49 | 95 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 1.7E-19 | 50 | 95 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 95 aa Download sequence Send to blast |
XSVVLLPPPN NINNNININI SDHHQNQIMG RRLVQSFGPA AAGTLNTITP CAACKLLRRR 60 CAEECPFSPY FSPQEPQKFA AVHKVFGASN VSKML |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 4e-19 | 40 | 95 | 1 | 56 | LOB family transfactor Ramosa2.1 |
5ly0_B | 4e-19 | 40 | 95 | 1 | 56 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_018623062.1 | 2e-36 | PREDICTED: LOB domain-containing protein 15-like isoform X1 | ||||
Swissprot | Q8L5T5 | 2e-30 | LBD15_ARATH; LOB domain-containing protein 15 | ||||
Swissprot | Q9AT61 | 4e-30 | LBD13_ARATH; LOB domain-containing protein 13 | ||||
TrEMBL | A0A2P5CYR2 | 2e-36 | A0A2P5CYR2_TREOI; Lateral organ boundaries domain containing protein | ||||
STRING | XP_009589291.1 | 9e-36 | (Nicotiana tomentosiformis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1334 | 34 | 105 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G40470.1 | 8e-33 | LOB domain-containing protein 15 |
Publications ? help Back to Top | |||
---|---|---|---|
|