|
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
PK17504.1 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
Family |
MYB_related |
Protein Properties |
Length: 61aa MW: 7046.89 Da PI: 9.9525 |
Description |
MYB_related family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
PK17504.1 | genome | CCBR | View CDS |
|
Signature Domain? help Back to Top |
|
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | Myb_DNA-binding | 62.9 | 6.6e-20 | 9 | 56 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT+eEd++lv+ +++ G g+W++ +r g++R++k+c++rw +yl
PK17504.1 9 KGPWTPEEDQKLVKFIQKNGHGSWRALPRLAGLNRCGKSCRLRWTNYL 56
79********************************************97 PP
|
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Transcription factor that acts as negative regulator of lateral root (LR) development. Required for normal auxin responses during LR development. May be part of a negative feedback loop stimulated specifically in the endodermis upon LR initiation to ensure that LRs are formed only in the correct place. {ECO:0000269|PubMed:24902892}. |
Regulation -- Description ? help
Back to Top |
Source |
Description |
UniProt | INDUCTION: Induced by abscisic acid (ABA), auxin and gravity in roots. {ECO:0000269|PubMed:24902892}. |