PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PK17295.1

Organism

Cannabis sativa

Taxonomic ID

3483

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis

Family

NAC

Protein Properties

Length: 91aa MW: 11109.7 Da PI: 8.4302

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PK17295.1	genome	CCBR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	95.6	7.5e-30	15	91	1	78
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknrat 78 + pGfrFhPtdeelv +yLk+k+++++l++ e ik++diyk++PwdLpk ++++ekewyf+++rd+ky++++r+nr+t PK17295.1 15 MLPGFRFHPTDEELVGFYLKRKIQQRPLSI-ELIKQLDIYKYDPWDLPKLASTGEKEWYFYCPRDRKYRNSTRPNRVT 91 579*************************.89***********9888999*******************86 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	8.24E-31	13	91	IPR003441	NAC domain
PROSITE profile	PS51005	30.741	15	91	IPR003441	NAC domain
Pfam	PF02365	4.1E-13	17	82	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 91 aa Download sequence Send to blast
MDHERSEGDK LEEVMLPGFR FHPTDEELVG FYLKRKIQQR PLSIELIKQL DIYKYDPWDL 60 PKLASTGEKE WYFYCPRDRK YRNSTRPNRV T

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	4e-28	7	91	8	93	NO APICAL MERISTEM PROTEIN
1ut4_B	4e-28	7	91	8	93	NO APICAL MERISTEM PROTEIN
1ut7_A	4e-28	7	91	8	93	NO APICAL MERISTEM PROTEIN
1ut7_B	4e-28	7	91	8	93	NO APICAL MERISTEM PROTEIN
3swm_A	5e-28	7	91	11	96	NAC domain-containing protein 19
3swm_B	5e-28	7	91	11	96	NAC domain-containing protein 19
3swm_C	5e-28	7	91	11	96	NAC domain-containing protein 19
3swm_D	5e-28	7	91	11	96	NAC domain-containing protein 19
3swp_A	5e-28	7	91	11	96	NAC domain-containing protein 19
3swp_B	5e-28	7	91	11	96	NAC domain-containing protein 19
3swp_C	5e-28	7	91	11	96	NAC domain-containing protein 19
3swp_D	5e-28	7	91	11	96	NAC domain-containing protein 19
4dul_A	4e-28	7	91	8	93	NAC domain-containing protein 19
4dul_B	4e-28	7	91	8	93	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Promotes periclinal root capforming cell divisions. Activates expression of its negative regulator SMB in a feedback loop for controlled switches in cell division plane. {ECO:0000269\|PubMed:19081078}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed by SMB in oriented-divised root cap stem cells. {ECO:0000269\|PubMed:19081078}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002522427.1	6e-56	protein FEZ
Refseq	XP_017222468.1	3e-56	PREDICTED: protein FEZ-like
Swissprot	Q9ZVH0	8e-49	FEZ_ARATH; Protein FEZ
TrEMBL	A0A2P5C967	1e-55	A0A2P5C967_PARAD; NAC domain containing protein
STRING	XP_002522427.1	2e-55	(Ricinus communis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF2013	34	90

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G26870.1	3e-51	NAC family protein

Publications ? help Back to Top
Bennett T,van den Toorn A,Willemsen V,Scheres B Precise control of plant stem cell activity through parallel regulatory inputs. Development, 2014. 141(21): p. 4055-64 [PMID:25256342]