![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PK15647.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 85aa MW: 9212.19 Da PI: 7.6133 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 56.1 | 1.1e-17 | 26 | 84 | 23 | 81 |
DUF260 23 paeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvil 81 p++q++++ +v+k+FG++ ++++++a+p+++r+++++sl+yeA r+ +Pv+Gavg+++ PK15647.1 26 PQAQAHATLFVAKFFGRAGLMSFISAVPQHHRPALFQSLLYEAVGRTVNPVNGAVGLLW 84 999*****************************************************998 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 11.752 | 3 | 85 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 2.0E-14 | 26 | 84 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 85 aa Download sequence Send to blast |
MAAEFSEKVA VIIVCLENVY SGXETPQAQA HATLFVAKFF GRAGLMSFIS AVPQHHRPAL 60 FQSLLYEAVG RTVNPVNGAV GLLWX |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004231911.1 | 3e-32 | LOB domain-containing protein 37 | ||||
Refseq | XP_006339815.1 | 2e-32 | PREDICTED: LOB domain-containing protein 37 | ||||
Refseq | XP_011088059.1 | 4e-32 | LOB domain-containing protein 37-like | ||||
Refseq | XP_016560963.1 | 3e-32 | PREDICTED: LOB domain-containing protein 37 | ||||
Refseq | XP_022033459.1 | 2e-32 | LOB domain-containing protein 38-like | ||||
Swissprot | Q9SN23 | 3e-31 | LBD38_ARATH; LOB domain-containing protein 38 | ||||
TrEMBL | A0A2P5EYF3 | 4e-35 | A0A2P5EYF3_TREOI; Lateral organ boundaries domain containing protein | ||||
STRING | Solyc02g092550.2.1 | 1e-31 | (Solanum lycopersicum) | ||||
STRING | PGSC0003DMT400064185 | 9e-32 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF721 | 34 | 136 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G49940.1 | 1e-33 | LOB domain-containing protein 38 |