![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PK11310.3 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 144aa MW: 16375.7 Da PI: 8.7524 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 76.2 | 5.4e-24 | 85 | 136 | 1 | 52 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEET CS SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhel 52 +C+ve+C++dl++ak+y+rrhkvC++hska+++lvs+++qrfCqqCsrf+ l PK11310.3 85 MCKVEDCSVDLTTAKDYNRRHKVCDMHSKATKALVSNTMQRFCQQCSRFYFL 136 6************************************************987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 8.4E-24 | 79 | 134 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 19.17 | 83 | 144 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 1.44E-22 | 84 | 136 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 3.9E-17 | 86 | 134 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 144 aa Download sequence Send to blast |
MEAKIGGKGS LEWDLNDWRW DGDLFNATPS LNSFPSSAHL SKNKRALLVH EEESNVSLKL 60 KLSISEESEV KKLKTVETSS SKSVMCKVED CSVDLTTAKD YNRRHKVCDM HSKATKALVS 120 NTMQRFCQQC SRFYFLFSVI VSKF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj0_A | 3e-21 | 83 | 136 | 3 | 56 | squamosa promoter-binding protein-like 12 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Binds specifically to the 5'-GTAC-3' core sequence. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:16095614}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021640197.1 | 9e-38 | squamosa promoter-binding-like protein 1 | ||||
Swissprot | Q9SMX9 | 8e-31 | SPL1_ARATH; Squamosa promoter-binding-like protein 1 | ||||
TrEMBL | A0A075FET0 | 2e-36 | A0A075FET0_SALMI; SQUAMOSA promoter binding protein-like 13 (Fragment) | ||||
STRING | POPTR_0010s16370.2 | 2e-36 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1539 | 34 | 95 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47070.1 | 2e-29 | squamosa promoter binding protein-like 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|