PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Protein Features |

3D Structure |

Orthologous Group |

Publication

Basic Information? help Back to Top

TF ID

PK09808.1

Organism

Cannabis sativa

Taxonomic ID

3483

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis

Family

LBD

Protein Properties

Length: 62aa MW: 6928.47 Da PI: 4.1935

Description

LBD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PK09808.1	genome	CCBR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	DUF260	64.9	2e-20	2	59	44	101
DUF260 44 kllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkeel 101 k+l++lp ++r da+sslvyeA+ar+rdPvyG+vg i+ lq+q+++l+ +lal+++e+ PK09808.1 2 KMLQELPFDQRADAVSSLVYEANARMRDPVYGCVGAISYLQNQVSELQMQLALAQAEI 59 89***************************************************99875 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50891	12.158	1	59	IPR004883	Lateral organ boundaries, LOB
Pfam	PF03195	1.7E-18	2	56	IPR004883	Lateral organ boundaries, LOB

Sequence ? help Back to Top
Protein Sequence Length: 62 aa Download sequence Send to blast
XKMLQELPFD QRADAVSSLV YEANARMRDP VYGCVGAISY LQNQVSELQM QLALAQAEIL 60 CX

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5ly0_A	3e-20	2	60	54	112	LOB family transfactor Ramosa2.1
5ly0_B	3e-20	2	60	54	112	LOB family transfactor Ramosa2.1
Search in ModeBase

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_024995747.1	1e-33	LOB domain-containing protein 12-like
Swissprot	Q8LBW3	2e-31	LBD12_ARATH; LOB domain-containing protein 12
TrEMBL	A0A103YJ26	2e-32	A0A103YJ26_CYNCS; Lateral organ boundaries domain-containing protein (Fragment)
STRING	XP_008233810.1	1e-32	(Prunus mume)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1664	34	97

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G30130.1	8e-34	LBD family protein

Publications ? help Back to Top
Penfield S, et al. Reserve mobilization in the Arabidopsis endosperm fuels hypocotyl elongation in the dark, is independent of abscisic acid, and requires PHOSPHOENOLPYRUVATE CARBOXYKINASE1. Plant Cell, 2004. 16(10): p. 2705-18 [PMID:15367715]