PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Protein Features |

Gene Ontology |

Function |

Orthologous Group |

Basic Information? help Back to Top

TF ID

PK09793.2

Organism

Cannabis sativa

Taxonomic ID

3483

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis

Family

GRF

Protein Properties

Length: 95aa MW: 11022.6 Da PI: 10.3266

Description

GRF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PK09793.2	genome	CCBR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRC	31.2	3.8e-10	78	94	1	17
WRC 1 daepgrCrRtDGKkWRC 17 d+epgrCrRtDGKkWRC PK09793.2 78 DPEPGRCRRTDGKKWRC 94 79*************** PP
2	QLQ	60.4	5.1e-21	8	42	2	36
QLQ 2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36 +FTa+Q+q+L++Q+l++Ky++++ P+Pp+Ll+ ++ PK09793.2 8 PFTASQWQELEHQALIFKYMVSGIPIPPDLLFTLK 42 8*****************************98765 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00951	2.7E-11	7	43	IPR014978	Glutamine-Leucine-Glutamine, QLQ
Pfam	PF08880	3.9E-16	8	41	IPR014978	Glutamine-Leucine-Glutamine, QLQ
PROSITE profile	PS51666	21.935	8	43	IPR014978	Glutamine-Leucine-Glutamine, QLQ
PROSITE profile	PS51667	13.747	78	95	IPR014977	WRC domain
Pfam	PF08879	7.6E-7	79	94	IPR014977	WRC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0005524	Molecular Function	ATP binding

Sequence ? help Back to Top
Protein Sequence Length: 95 aa Download sequence Send to blast
MSGKTRFPFT ASQWQELEHQ ALIFKYMVSG IPIPPDLLFT LKRSYLDSTA VLPSKLFPHH 60 SQHVGWNCFQ MGLGRKIDPE PGRCRRTDGK KWRCX

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that plays a role in the regulation of cell expansion in leaf and cotyledons tissues. Acts together with GIF1 for the development of appropriate leaf size and shape through the promotion and/or maintenance of cell proliferation activity in leaf primordia. {ECO:0000269\|PubMed:15326298, ECO:0000269\|PubMed:15960617}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_024932189.1	3e-57	growth-regulating factor 5-like isoform X7
Swissprot	Q8L8A6	2e-38	GRF5_ARATH; Growth-regulating factor 5
TrEMBL	A0A2P5BXX4	2e-59	A0A2P5BXX4_PARAD; Growth-regulating factor
STRING	EMJ05977	3e-50	(Prunus persica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF4043	34	59

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G13960.1	7e-41	growth-regulating factor 5