![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PK02601.2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
|
||||||||
Family | G2-like | ||||||||
Protein Properties | Length: 107aa MW: 12468.4 Da PI: 10.132 | ||||||||
Description | G2-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 92.3 | 4e-29 | 53 | 107 | 1 | 56 |
G2-like 1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 kpr+ W+ eLH++Fv av+qL G++kA+Pk+il+lm+v+ Lt+e+v+SHLQkYRl+ PK02601.2 53 KPRVIWSLELHQKFVTAVNQL-GIDKAVPKKILHLMNVDNLTRENVASHLQKYRLY 107 79*******************.********************************85 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50110 | 12.733 | 1 | 36 | IPR001789 | Signal transduction response regulator, receiver domain |
Gene3D | G3DSA:3.40.50.2300 | 1.8E-9 | 4 | 53 | No hit | No description |
SuperFamily | SSF52172 | 1.9E-6 | 4 | 42 | IPR011006 | CheY-like superfamily |
SuperFamily | SSF46689 | 1.06E-19 | 50 | 106 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 12.297 | 50 | 107 | IPR017930 | Myb domain |
TIGRFAMs | TIGR01557 | 3.0E-25 | 53 | 106 | IPR006447 | Myb domain, plants |
Gene3D | G3DSA:1.10.10.60 | 1.4E-29 | 54 | 107 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 2.7E-8 | 58 | 105 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0000160 | Biological Process | phosphorelay signal transduction system | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 107 aa Download sequence Send to blast |
MGXPKLVMKG ITEGACDYLL KPVRIEELKN IWKHVIRGKK NEFDDDEPST QKKPRVIWSL 60 ELHQKFVTAV NQLGIDKAVP KKILHLMNVD NLTRENVASH LQKYRLY |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1irz_A | 9e-25 | 49 | 106 | 1 | 58 | ARR10-B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}. | |||||
UniProt | Transcriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021640825.1 | 9e-49 | LOW QUALITY PROTEIN: two-component response regulator ARR12-like | ||||
Swissprot | B8AEH1 | 2e-43 | ORR23_ORYSI; Two-component response regulator ORR23 | ||||
Swissprot | Q6K8X6 | 2e-43 | ORR23_ORYSJ; Two-component response regulator ORR23 | ||||
TrEMBL | A0A1S3BUB4 | 5e-47 | A0A1S3BUB4_CUCME; Two-component response regulator | ||||
TrEMBL | A0A445K107 | 5e-47 | A0A445K107_GLYSO; Two-component response regulator | ||||
STRING | XP_008452870.1 | 9e-48 | (Cucumis melo) | ||||
STRING | XP_004157093.1 | 1e-47 | (Cucumis sativus) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF18475 | 3 | 5 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G31920.1 | 2e-44 | response regulator 10 |
Publications ? help Back to Top | |||
---|---|---|---|
|