PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis

Family

MYB

Protein Properties

Length: 146aa MW: 17082.9 Da PI: 10.0314

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PK01212.1	genome	CCBR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	54.9	2e-17	22	67	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg W + Ede+l ++v ++G+ +W+ Ia++++ gR++k+c++rw++ PK01212.1 22 RGHWRPGEDEKLRELVDRYGPQNWNFIAEHLQ-GRSGKSCRLRWYNQ 67 899***************************.**********96 PP
2	Myb_DNA-binding	53.1	7.3e-17	74	118	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++++T+eE+e+l+ a++ +G++ W+ Ia+++ gRt++ +k++++ + PK01212.1 74 KKPFTEEEEERLLAAHRIYGNK-WACIAKYFH-GRTDNAVKNHYHVV 118 689*****************.*****.*********976 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	25.048	17	72	IPR017930	Myb domain
SuperFamily	SSF46689	8.41E-30	20	115	IPR009057	Homeodomain-like
SMART	SM00717	4.6E-14	21	70	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	4.1E-27	23	75	IPR009057	Homeodomain-like
Pfam	PF13921	6.2E-18	25	85	No hit	No description
CDD	cd00167	1.18E-11	25	66	No hit	No description
PROSITE profile	PS51294	18.966	73	123	IPR017930	Myb domain
SMART	SM00717	1.4E-13	73	121	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	8.5E-21	76	121	IPR009057	Homeodomain-like
CDD	cd00167	2.04E-4	85	119	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 146 aa Download sequence Send to blast
MERSSSSMSS DHGGGGGKNC YRGHWRPGED EKLRELVDRY GPQNWNFIAE HLQGRSGKSC 60 RLRWYNQLDP NINKKPFTEE EEERLLAAHR IYGNKWACIA KYFHGRTDNA VKNHYHVVMA 120 RRKRERFSSS SSSPNSHHLI HNHNHN

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	4e-34	16	122	1	107	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor required for sugar partitioning from leaves to anthers during male reproductive development. Required for the production of functional pollen grains. Binds to the promoter of the anther-specific sugar transporter MST8 and regulates its expression. Regulates the expression of genes involved in sugar partitioning in flower, such as the sugar transporter SUT3, the invertase INV4, the UDP-glucose pyrophosphorylase UGP2 and the starch synthase WAXY. {ECO:0000269\|PubMed:20305120}.
UniProt	Transcription factor that confers sensitivity to abscisic acid (ABA) and salt, but tolerance to drought (PubMed:21399993). Regulates secondary cell wall (SCW) biosynthesis, especially in interfascicular and xylary fibers (PubMed:18952777, PubMed:23781226). {ECO:0000269\|PubMed:18952777, ECO:0000269\|PubMed:21399993, ECO:0000269\|PubMed:23781226}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By abscisic acid (PubMed:16463103, PubMed:21399993). Accumulates in response to salt (PubMed:21399993). Triggered by MYB46 and MYB83 in the regulation of secondary cell wall biosynthesis (PubMed:19674407, PubMed:22197883). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:19674407, ECO:0000269\|PubMed:21399993, ECO:0000269\|PubMed:22197883}.
UniProt	INDUCTION: Induced by wounding. {ECO:0000269\|PubMed:20305120}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010090845.2	1e-78	transcription factor CSA
Swissprot	Q5NBM8	3e-58	CSA_ORYSJ; Transcription factor CSA
Swissprot	Q6R0C4	5e-59	MYB52_ARATH; Transcription factor MYB52
TrEMBL	A0A2P5E8W7	3e-77	A0A2P5E8W7_TREOI; MYB transcription factor
STRING	XP_010090845.1	2e-77	(Morus notabilis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF230	34	243

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G33450.1	1e-59	myb domain protein 69

Publications ? help Back to Top
Leonard LM,Follette VM Sexual functioning in women reporting a history of child sexual abuse: review of the empirical literature and clinical implications. Annu Rev Sex Res, 2002. 13: p. 346-88 [PMID:12836736] Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Wang L,Li X,Chen Z Sulfated modification of the polysaccharides obtained from defatted rice bran and their antitumor activities. Int. J. Biol. Macromol., 2009. 44(2): p. 211-4 [PMID:19135473] Wang L,Huang H,Wei Y,Li X,Chen Z Characterization and anti-tumor activities of sulfated polysaccharide SRBPS2a obtained from defatted rice bran. Int. J. Biol. Macromol., 2009. 45(4): p. 427-31 [PMID:19549538] Zhang H, et al. Carbon starved anther encodes a MYB domain protein that regulates sugar partitioning required for rice pollen development. Plant Cell, 2010. 22(3): p. 672-89 [PMID:20305120] Zhang H, et al. Mutation in CSA creates a new photoperiod-sensitive genic male sterile line applicable for hybrid rice seed production. Proc. Natl. Acad. Sci. U.S.A., 2013. 110(1): p. 76-81 [PMID:23256151] Cassan-Wang H, et al. Identification of novel transcription factors regulating secondary cell wall formation in Arabidopsis. Front Plant Sci, 2013. 4: p. 189 [PMID:23781226] Zhu X, et al. Brassinosteroids promote development of rice pollen grains and seeds by triggering expression of Carbon Starved Anther, a MYB domain protein. Plant J., 2015. 82(4): p. 570-81 [PMID:25754973] Li X, et al. Metabolic and transcriptomic signatures of rice floral organs reveal sugar starvation as a factor in reproductive failure under heat and drought stress. Plant Cell Environ., 2015. 38(10): p. 2171-92 [PMID:25828772] Shaar-Moshe L,Hübner S,Peleg Z Identification of conserved drought-adaptive genes using a cross-species meta-analysis approach. BMC Plant Biol., 2015. 15: p. 111 [PMID:25935420] Shi D, et al. MYB52 Negatively Regulates Pectin Demethylesterification in Seed Coat Mucilage. Plant Physiol., 2018. 176(4): p. 2737-2749 [PMID:29440562]