![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PH01001858G0120 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
|
||||||||
Family | HSF | ||||||||
Protein Properties | Length: 78aa MW: 8804.86 Da PI: 4.8596 | ||||||||
Description | HSF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | HSF_DNA-bind | 86.7 | 3.2e-27 | 12 | 74 | 2 | 64 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE CS HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkk 64 Fl+k+y++++d++++ ++sws+ +nsfvv+d++ fa+ +Lp+yFkh+nf+SFvRQLn+Y+ ++ PH01001858G0120 12 FLTKTYDMVDDPTTDGIVSWSAMNNSFVVWDPHAFATVLLPRYFKHNNFSSFVRQLNTYEHSE 74 9**********************************************************9875 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.10 | 5.6E-29 | 6 | 74 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SuperFamily | SSF46785 | 3.13E-25 | 8 | 75 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
SMART | SM00415 | 2.4E-24 | 8 | 74 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Pfam | PF00447 | 5.5E-23 | 12 | 74 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 1.5E-17 | 12 | 35 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 1.5E-17 | 50 | 62 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
PRINTS | PR00056 | 1.5E-17 | 63 | 75 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 78 aa Download sequence Send to blast |
MEGLHDAGPP PFLTKTYDMV DDPTTDGIVS WSAMNNSFVV WDPHAFATVL LPRYFKHNNF 60 SSFVRQLNTY EHSEIPC* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5d5u_B | 8e-20 | 7 | 75 | 21 | 92 | Heat shock factor protein 1 |
5d5v_B | 8e-20 | 7 | 75 | 21 | 92 | Heat shock factor protein 1 |
5d5v_D | 8e-20 | 7 | 75 | 21 | 92 | Heat shock factor protein 1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional regulator that specifically binds DNA of heat shock promoter elements (HSE). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PH01001858G0120 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By heat stress. {ECO:0000269|PubMed:18064488}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | KF208544 | 3e-64 | KF208544.1 Triticum aestivum heat shock factor A2b (HsfA2b) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004981438.2 | 3e-42 | heat stress transcription factor A-2e | ||||
Swissprot | Q6VBB2 | 2e-41 | HFA2B_ORYSJ; Heat stress transcription factor A-2b | ||||
TrEMBL | A0A287H5F0 | 6e-42 | A0A287H5F0_HORVV; Uncharacterized protein | ||||
STRING | Pavir.J04151.1.p | 2e-42 | (Panicum virgatum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP308 | 37 | 231 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G22830.1 | 3e-38 | heat shock transcription factor A6B |
Publications ? help Back to Top | |||
---|---|---|---|
|