![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PH01000664G0320 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 117aa MW: 13253.9 Da PI: 9.1088 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 49.9 | 7e-16 | 59 | 111 | 3 | 55 |
XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 + +r++r++kNRe+A rsR+RK+a+i+eLe v +Le+e +L elee +++ PH01000664G0320 59 AMQRQKRMIKNRESAARSRERKQAYIAELEAQVTQLEEEHAQLLRELEEQNQK 111 689*****************************************888876655 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PRINTS | PR00041 | 5.7E-5 | 56 | 72 | IPR001630 | cAMP response element binding (CREB) protein |
SMART | SM00338 | 5.6E-8 | 57 | 115 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 2.4E-14 | 59 | 110 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 11.174 | 59 | 111 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14707 | 6.96E-15 | 61 | 108 | No hit | No description |
SuperFamily | SSF57959 | 3.5E-12 | 61 | 110 | No hit | No description |
Gene3D | G3DSA:1.20.5.170 | 1.6E-14 | 62 | 110 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 64 | 79 | IPR004827 | Basic-leucine zipper domain |
PRINTS | PR00041 | 5.7E-5 | 74 | 94 | IPR001630 | cAMP response element binding (CREB) protein |
PRINTS | PR00041 | 5.7E-5 | 94 | 111 | IPR001630 | cAMP response element binding (CREB) protein |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 117 aa Download sequence Send to blast |
MTLEDFLARE DDTRVEGVEG KMVVGFPDRA EDAARGGRGS AGGGRGRKRA LVDQMDRAAM 60 QRQKRMIKNR ESAARSRERK QAYIAELEAQ VTQLEEEHAQ LLRELEEQNQ KRLKEI* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 35 | 43 | GGRGSAGGG |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription activator that binds to the ABA-responsive elements (ABREs) in vitro. Involved in abiotic stress responses and abscisic acid (ABA) signaling (PubMed:20039193). Involved in the signaling pathway that induces growth inhibition in response to D-allose (PubMed:23397192). {ECO:0000269|PubMed:20039193, ECO:0000269|PubMed:23397192}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PH01000664G0320 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Induced by anoxia, drought, salt stress, oxidative stress, cold and abscisic acid (ABA) (PubMed:20039193). Induced by D-allose (PubMed:23397192). {ECO:0000269|PubMed:20039193, ECO:0000269|PubMed:23397192}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006655359.2 | 4e-47 | PREDICTED: G-box-binding factor 4-like | ||||
Refseq | XP_015639395.1 | 2e-46 | bZIP transcription factor 12-like | ||||
Swissprot | Q0JHF1 | 6e-40 | BZP12_ORYSJ; bZIP transcription factor 12 | ||||
TrEMBL | A0A0D3G841 | 3e-46 | A0A0D3G841_9ORYZ; Uncharacterized protein | ||||
TrEMBL | Q84P61 | 3e-46 | Q84P61_ORYSJ; OSE2-like protein (Fragment) | ||||
STRING | OMERI05G14750.1 | 2e-46 | (Oryza meridionalis) | ||||
STRING | OB05G25740.1 | 6e-47 | (Oryza brachyantha) | ||||
STRING | ORGLA05G0154900.1 | 1e-46 | (Oryza glaberrima) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2665 | 37 | 86 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G03970.1 | 2e-21 | G-box binding factor 4 |
Publications ? help Back to Top | |||
---|---|---|---|
|