PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum

Family

M-type_MADS

Protein Properties

Length: 153aa MW: 17130.5 Da PI: 9.8313

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PGSC0003DMP400061939	genome	PGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	69.1	4.2e-22	15	61	3	49
--SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS SRF-TF 3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 n+sn qvtfskRr g++KKA ELS+LC+a+v +++fs+++k y y PGSC0003DMP400061939 15 MPNQSNLQVTFSKRRDGVFKKATELSTLCGADVVIVVFSPSNKPYSY 61 569***************************************99888 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	1.8E-29	5	64	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	24.165	5	65	IPR002100	Transcription factor, MADS-box
CDD	cd00265	3.75E-32	6	77	No hit	No description
SuperFamily	SSF55455	1.83E-26	6	79	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.5E-19	7	27	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.4E-23	16	61	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.5E-19	27	42	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	5.5E-19	42	63	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 153 aa Download sequence Send to blast
MRRPNGRRRV EMTRMPNQSN LQVTFSKRRD GVFKKATELS TLCGADVVIV VFSPSNKPYS 60 YGHPSVESIM NRFLGGNPPT DTDAPNPIVI AHQNANTDEI NRKLNRLEIS LEREKKYGEA 120 LQASRKEPPI EKLSSFDLKN MCKALEAADE VN*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3kov_A	2e-17	6	91	1	86	Myocyte-specific enhancer factor 2A
3kov_B	2e-17	6	91	1	86	Myocyte-specific enhancer factor 2A
3kov_I	2e-17	6	91	1	86	Myocyte-specific enhancer factor 2A
3kov_J	2e-17	6	91	1	86	Myocyte-specific enhancer factor 2A
3p57_A	2e-17	6	91	1	86	Myocyte-specific enhancer factor 2A
3p57_B	2e-17	6	91	1	86	Myocyte-specific enhancer factor 2A
3p57_C	2e-17	6	91	1	86	Myocyte-specific enhancer factor 2A
3p57_D	2e-17	6	91	1	86	Myocyte-specific enhancer factor 2A
3p57_I	2e-17	6	91	1	86	Myocyte-specific enhancer factor 2A
3p57_J	2e-17	6	91	1	86	Myocyte-specific enhancer factor 2A
Search in ModeBase

Cis-element ? help Back to Top
Source	Link
PlantRegMap	PGSC0003DMP400061939

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC243026	0.0	AC243026.1 Solanum tuberosum chromosome 11 clone RH059C07, complete sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006362321.1	1e-101	PREDICTED: agamous-like MADS-box protein AGL62
TrEMBL	M1DK05	1e-109	M1DK05_SOLTU; Uncharacterized protein
STRING	PGSC0003DMT400090264	1e-109	(Solanum tuberosum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA204	24	223

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G60440.1	8e-35	AGAMOUS-like 62

Link Out ? help Back to Top
Phytozome	PGSC0003DMP400061939

Publications ? help Back to Top
Xu X, et al. Genome sequence and analysis of the tuber crop potato. Nature, 2011. 475(7355): p. 189-95 [PMID:21743474]