![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PGSC0003DMP400061939 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 153aa MW: 17130.5 Da PI: 9.8313 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 69.1 | 4.2e-22 | 15 | 61 | 3 | 49 |
--SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS SRF-TF 3 ienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49 n+sn qvtfskRr g++KKA ELS+LC+a+v +++fs+++k y y PGSC0003DMP400061939 15 MPNQSNLQVTFSKRRDGVFKKATELSTLCGADVVIVVFSPSNKPYSY 61 569***************************************99888 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00432 | 1.8E-29 | 5 | 64 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS50066 | 24.165 | 5 | 65 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 3.75E-32 | 6 | 77 | No hit | No description |
SuperFamily | SSF55455 | 1.83E-26 | 6 | 79 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.5E-19 | 7 | 27 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.4E-23 | 16 | 61 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.5E-19 | 27 | 42 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.5E-19 | 42 | 63 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 153 aa Download sequence Send to blast |
MRRPNGRRRV EMTRMPNQSN LQVTFSKRRD GVFKKATELS TLCGADVVIV VFSPSNKPYS 60 YGHPSVESIM NRFLGGNPPT DTDAPNPIVI AHQNANTDEI NRKLNRLEIS LEREKKYGEA 120 LQASRKEPPI EKLSSFDLKN MCKALEAADE VN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3kov_A | 2e-17 | 6 | 91 | 1 | 86 | Myocyte-specific enhancer factor 2A |
3kov_B | 2e-17 | 6 | 91 | 1 | 86 | Myocyte-specific enhancer factor 2A |
3kov_I | 2e-17 | 6 | 91 | 1 | 86 | Myocyte-specific enhancer factor 2A |
3kov_J | 2e-17 | 6 | 91 | 1 | 86 | Myocyte-specific enhancer factor 2A |
3p57_A | 2e-17 | 6 | 91 | 1 | 86 | Myocyte-specific enhancer factor 2A |
3p57_B | 2e-17 | 6 | 91 | 1 | 86 | Myocyte-specific enhancer factor 2A |
3p57_C | 2e-17 | 6 | 91 | 1 | 86 | Myocyte-specific enhancer factor 2A |
3p57_D | 2e-17 | 6 | 91 | 1 | 86 | Myocyte-specific enhancer factor 2A |
3p57_I | 2e-17 | 6 | 91 | 1 | 86 | Myocyte-specific enhancer factor 2A |
3p57_J | 2e-17 | 6 | 91 | 1 | 86 | Myocyte-specific enhancer factor 2A |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PGSC0003DMP400061939 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC243026 | 0.0 | AC243026.1 Solanum tuberosum chromosome 11 clone RH059C07, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006362321.1 | 1e-101 | PREDICTED: agamous-like MADS-box protein AGL62 | ||||
TrEMBL | M1DK05 | 1e-109 | M1DK05_SOLTU; Uncharacterized protein | ||||
STRING | PGSC0003DMT400090264 | 1e-109 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA204 | 24 | 223 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G60440.1 | 8e-35 | AGAMOUS-like 62 |
Link Out ? help Back to Top | |
---|---|
Phytozome | PGSC0003DMP400061939 |
Publications ? help Back to Top | |||
---|---|---|---|
|