![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PGSC0003DMP400047411 | ||||||||
Common Name | LOC102587928 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | GATA | ||||||||
Protein Properties | Length: 170aa MW: 18833.6 Da PI: 10.0923 | ||||||||
Description | GATA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | GATA | 55.9 | 5.6e-18 | 61 | 94 | 1 | 34 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 C +C tkTp+WR gp g+ktLCnaCG++y+k + PGSC0003DMP400047411 61 CLHCEITKTPQWRAGPMGPKTLCNACGVRYKKGR 94 99******************************87 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00401 | 3.8E-17 | 55 | 105 | IPR000679 | Zinc finger, GATA-type |
PROSITE profile | PS50114 | 11.49 | 55 | 91 | IPR000679 | Zinc finger, GATA-type |
SuperFamily | SSF57716 | 6.65E-16 | 59 | 118 | No hit | No description |
Gene3D | G3DSA:3.30.50.10 | 2.8E-15 | 59 | 94 | IPR013088 | Zinc finger, NHR/GATA-type |
CDD | cd00202 | 1.52E-14 | 60 | 107 | No hit | No description |
Pfam | PF00320 | 8.6E-16 | 61 | 95 | IPR000679 | Zinc finger, GATA-type |
PROSITE pattern | PS00344 | 0 | 61 | 86 | IPR000679 | Zinc finger, GATA-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0008270 | Molecular Function | zinc ion binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 170 aa Download sequence Send to blast |
MFPTSVIPQQ FVAPGVNSLE SENFAESPMK KKKKIKLSIP LAPIETNQDN YQPAPQAVRK 60 CLHCEITKTP QWRAGPMGPK TLCNACGVRY KKGRLYPEYR PAASPTFVPS LHSNSHKKVL 120 EMRSNVFPEE DTDYKQAKPR QARPLIIGQA ENNTTASTTP TAQSDLNPK* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PGSC0003DMP400047411 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975443 | 0.0 | HG975443.1 Solanum pennellii chromosome ch04, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006350222.1 | 1e-122 | PREDICTED: GATA transcription factor 8-like | ||||
Refseq | XP_006350223.1 | 1e-122 | PREDICTED: GATA transcription factor 8-like | ||||
Swissprot | Q9SV30 | 2e-40 | GATA8_ARATH; GATA transcription factor 8 | ||||
TrEMBL | M1CLQ8 | 1e-122 | M1CLQ8_SOLTU; Uncharacterized protein | ||||
TrEMBL | M1CLQ9 | 1e-120 | M1CLQ9_SOLTU; GATA transcription factor | ||||
STRING | PGSC0003DMT400070134 | 1e-121 | (Solanum tuberosum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G54810.2 | 2e-42 | GATA family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | PGSC0003DMP400047411 |
Entrez Gene | 102587928 |
Publications ? help Back to Top | |||
---|---|---|---|
|