![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PGSC0003DMP400036346 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | S1Fa-like | ||||||||
Protein Properties | Length: 79aa MW: 8750.54 Da PI: 10.5915 | ||||||||
Description | S1Fa-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | S1FA | 118.9 | 1.9e-37 | 3 | 63 | 4 | 64 |
S1FA 4 akveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqG 64 + ve+ G+nPGlivllv+ggl+l+fl+gny+lyvyaqk+lPP+kkkP+skkk+k+e+lkq PGSC0003DMP400036346 3 KDVEVNGFNPGLIVLLVIGGLVLTFLIGNYVLYVYAQKTLPPKKKKPISKKKMKKERLKQD 63 568********************************************************95 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF04689 | 9.8E-35 | 5 | 62 | IPR006779 | DNA binding protein S1FA |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0016021 | Cellular Component | integral component of membrane | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 79 aa Download sequence Send to blast |
MAKDVEVNGF NPGLIVLLVI GGLVLTFLIG NYVLYVYAQK TLPPKKKKPI SKKKMKKERL 60 KQDRTSKTAF AAFYCATD* |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PGSC0003DMP400036346 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC254722 | 8e-93 | AC254722.3 Solanum lycopersicum strain Heinz 1706 chromosome 10 clone hba-53k5 map 10, complete sequence. | |||
GenBank | HG975522 | 8e-93 | HG975522.1 Solanum lycopersicum chromosome ch10, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004249690.1 | 1e-36 | DNA-binding protein S1FA | ||||
Refseq | XP_006361668.1 | 1e-36 | PREDICTED: DNA-binding protein S1FA-like | ||||
Refseq | XP_015055951.1 | 1e-36 | DNA-binding protein S1FA-like | ||||
Refseq | XP_015055952.1 | 1e-36 | DNA-binding protein S1FA-like | ||||
Refseq | XP_016543084.1 | 1e-36 | PREDICTED: DNA-binding protein S1FA-like | ||||
Refseq | XP_016543085.1 | 1e-36 | PREDICTED: DNA-binding protein S1FA-like | ||||
Refseq | XP_019071702.1 | 1e-36 | DNA-binding protein S1FA | ||||
TrEMBL | M1BVN6 | 7e-49 | M1BVN6_SOLTU; Uncharacterized protein | ||||
STRING | PGSC0003DMT400053952 | 1e-49 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA3174 | 22 | 49 |
Link Out ? help Back to Top | |
---|---|
Phytozome | PGSC0003DMP400036346 |
Publications ? help Back to Top | |||
---|---|---|---|
|