PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum

Family

bZIP

Protein Properties

Length: 159aa MW: 17319.3 Da PI: 10.5173

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PGSC0003DMP400036125	genome	PGSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	46.6	7.5e-15	84	144	1	61
XXXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 1 ekelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 +ke kr +r+ +NR++A+ R+RKka++ Le +vkeLe++N +L ++l++l++e + l+ PGSC0003DMP400036125 84 DKENKRLKRLLRNRVSAQQARERKKAYLIDLEARVKELETKNAELEERLSTLQNENQMLRH 144 5899****************************************************98865 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00338	4.4E-14	84	148	IPR004827	Basic-leucine zipper domain
Pfam	PF00170	1.0E-13	85	145	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	12.461	86	149	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	3.13E-13	88	146	No hit	No description
Gene3D	G3DSA:1.20.5.170	1.0E-16	88	148	No hit	No description
CDD	cd14704	6.87E-16	89	140	No hit	No description
PROSITE pattern	PS00036	0	91	106	IPR004827	Basic-leucine zipper domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009737	Biological Process	response to abscisic acid
GO:0009740	Biological Process	gibberellic acid mediated signaling pathway
GO:0010017	Biological Process	red or far-red light signaling pathway
GO:0010099	Biological Process	regulation of photomorphogenesis
GO:0010114	Biological Process	response to red light
GO:0010218	Biological Process	response to far red light
GO:0010224	Biological Process	response to UV-B
GO:0031539	Biological Process	positive regulation of anthocyanin metabolic process
GO:0042753	Biological Process	positive regulation of circadian rhythm
GO:0080167	Biological Process	response to karrikin
GO:0005634	Cellular Component	nucleus
GO:0003690	Molecular Function	double-stranded DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 159 aa Download sequence Send to blast
MQEQATSSIA ASSLPSSSER SSSSALHLEL KEGMESDDEI RRVPEMGGEA TGTMSASGRD 60 GASAAGQAQP SAGTQRKRGR SPADKENKRL KRLLRNRVSA QQARERKKAY LIDLEARVKE 120 LETKNAELEE RLSTLQNENQ MLRHILKNTT AGAKEGRK*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
2oqq_A	6e-16	109	148	3	42	Transcription factor HY5
2oqq_B	6e-16	109	148	3	42	Transcription factor HY5
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that promotes photomorphogenesis in the light and positively regulates fruit pigmentation and fruit nutritional quality. Probably acts downstream of the light receptor network and directly affects transcription of light-induced genes. {ECO:0000269\|PubMed:15178762}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00117	ampDAP	Transfer from AT5G11260	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	PGSC0003DMP400036125

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AJ011914	0.0	AJ011914.1 Solanum lycopersicum mRNA for THY5 protein.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_006361723.1	1e-108	PREDICTED: transcription factor HY5
Swissprot	Q9SM50	1e-95	HY5_SOLLC; Transcription factor HY5
TrEMBL	M1BV55	1e-107	M1BV55_SOLTU; Uncharacterized protein
STRING	PGSC0003DMT400053576	2e-97	(Solanum tuberosum)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G11260.1	3e-46	bZIP family protein

Link Out ? help Back to Top
Phytozome	PGSC0003DMP400036125
Entrez Gene	102588526

Publications ? help Back to Top
Xu X, et al. Genome sequence and analysis of the tuber crop potato. Nature, 2011. 475(7355): p. 189-95 [PMID:21743474] Wang F, et al. Light Signaling-Dependent Regulation of Photoinhibition and Photoprotection in Tomato. Plant Physiol., 2018. 176(2): p. 1311-1326 [PMID:29146776] Liu CC, et al. The bZip transcription factor HY5 mediates CRY1a-induced anthocyanin biosynthesis in tomato. Plant Cell Environ., 2018. 41(8): p. 1762-1775 [PMID:29566255]