![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PGSC0003DMP400011154 | ||||||||
Common Name | LOC107062522 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 198aa MW: 21610.4 Da PI: 7.3892 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 75.2 | 5.1e-24 | 14 | 59 | 2 | 47 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEE CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgkly 47 ri+n++n qvtfskRr+g++KKA+ELS+LC+a+va++ fs+++k+y PGSC0003DMP400011154 14 RIQNQTNLQVTFSKRRAGLFKKASELSTLCGANVAIVAFSPSNKVY 59 8*******************************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 24.824 | 5 | 65 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.8E-32 | 5 | 64 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 1.55E-31 | 6 | 73 | No hit | No description |
SuperFamily | SSF55455 | 3.4E-27 | 6 | 78 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.3E-20 | 7 | 27 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 1.7E-24 | 14 | 59 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.3E-20 | 27 | 42 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 5.3E-20 | 42 | 63 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 198 aa Download sequence Send to blast |
MRRPNGRKKI EIARIQNQTN LQVTFSKRRA GLFKKASELS TLCGANVAIV AFSPSNKVYA 60 CGHPSVESIV DKFVGENPPP DTDDPNPIIV AHQNANIDEI NEKLNKLERS LERERKHGQA 120 LQALRTEPSN EKLSFFDLKI LCESLEAADK KVEKLASQLM ECGIEFPYQT IGSALAPLRA 180 RESTSSDSGE GSSGSGE* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3kov_A | 5e-18 | 6 | 91 | 1 | 86 | Myocyte-specific enhancer factor 2A |
3kov_B | 5e-18 | 6 | 91 | 1 | 86 | Myocyte-specific enhancer factor 2A |
3kov_I | 5e-18 | 6 | 91 | 1 | 86 | Myocyte-specific enhancer factor 2A |
3kov_J | 5e-18 | 6 | 91 | 1 | 86 | Myocyte-specific enhancer factor 2A |
3p57_A | 5e-18 | 6 | 91 | 1 | 86 | Myocyte-specific enhancer factor 2A |
3p57_B | 5e-18 | 6 | 91 | 1 | 86 | Myocyte-specific enhancer factor 2A |
3p57_C | 5e-18 | 6 | 91 | 1 | 86 | Myocyte-specific enhancer factor 2A |
3p57_D | 5e-18 | 6 | 91 | 1 | 86 | Myocyte-specific enhancer factor 2A |
3p57_I | 5e-18 | 6 | 91 | 1 | 86 | Myocyte-specific enhancer factor 2A |
3p57_J | 5e-18 | 6 | 91 | 1 | 86 | Myocyte-specific enhancer factor 2A |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PGSC0003DMP400011154 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975440 | 0.0 | HG975440.1 Solanum pennellii chromosome ch01, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_015168708.1 | 1e-143 | PREDICTED: agamous-like MADS-box protein AGL62 | ||||
TrEMBL | M1A732 | 1e-142 | M1A732_SOLTU; Uncharacterized protein | ||||
STRING | PGSC0003DMT400016092 | 1e-143 | (Solanum tuberosum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA204 | 24 | 223 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G60440.1 | 3e-32 | AGAMOUS-like 62 |
Link Out ? help Back to Top | |
---|---|
Phytozome | PGSC0003DMP400011154 |
Entrez Gene | 107062522 |
Publications ? help Back to Top | |||
---|---|---|---|
|