PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PGSC0003DMP400002597 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 76aa MW: 8800.06 Da PI: 9.758 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 63.3 | 4.1e-20 | 20 | 59 | 20 | 59 |
S-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 20 fprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 rsYYrCt++gC+v+k+ver+++dpk+v++tY g+Hnh+ PGSC0003DMP400002597 20 IYRSYYRCTYPGCNVRKQVERASTDPKAVITTYDGKHNHD 59 56*************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF118290 | 1.7E-16 | 18 | 61 | IPR003657 | WRKY domain |
SMART | SM00774 | 1.0E-11 | 18 | 60 | IPR003657 | WRKY domain |
Gene3D | G3DSA:2.20.25.80 | 4.8E-19 | 20 | 61 | IPR003657 | WRKY domain |
Pfam | PF03106 | 6.6E-15 | 20 | 59 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 21.528 | 22 | 61 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 76 aa Download sequence Send to blast |
MCPVVLLDDM NNPLMHLNLI YRSYYRCTYP GCNVRKQVER ASTDPKAVIT TYDGKHNHDI 60 PTVRNRGTRN KYSQR* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 1e-19 | 4 | 62 | 14 | 78 | Probable WRKY transcription factor 4 |
2lex_A | 1e-19 | 4 | 62 | 14 | 78 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Has a positive role in resistance to necrotrophic pathogens (e.g. Botrytis cinerea), but a negative effect on plant resistance to biotrophic pathogens (e.g. Pseudomonas syringae). {ECO:0000269|PubMed:18570649, ECO:0000269|PubMed:22219184}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | PGSC0003DMP400002597 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By biotic and abiotic stresses such as pathogen infection (e.g. Botrytis cinerea and Pseudomonas syringae), salicylic acid (SA), jasmonic acid (JA), ethylene (ACC), liquid infiltration or spraying, and strongly during leaf senescence. {ECO:0000269|PubMed:11449049, ECO:0000269|PubMed:11722756, ECO:0000269|PubMed:18570649}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | HG975441 | 4e-88 | HG975441.1 Solanum pennellii chromosome ch02, complete genome. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | NP_001305593.1 | 3e-31 | probable WRKY transcription factor 3 | ||||
Swissprot | Q9XI90 | 5e-17 | WRKY4_ARATH; Probable WRKY transcription factor 4 | ||||
TrEMBL | M0ZM19 | 8e-49 | M0ZM19_SOLTU; Uncharacterized protein | ||||
STRING | PGSC0003DMT400003637 | 1e-30 | (Solanum tuberosum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G13960.2 | 3e-20 | WRKY DNA-binding protein 4 |
Link Out ? help Back to Top | |
---|---|
Phytozome | PGSC0003DMP400002597 |
Publications ? help Back to Top | |||
---|---|---|---|
|