PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Protein Features |

Gene Ontology |

Function |

Regulation |

Publication

Basic Information? help Back to Top

TF ID

PEQU_42224

Organism

Phalaenopsis equestris

Taxonomic ID

78828

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis

Family

MYB_related

Protein Properties

Length: 49aa MW: 5621.47 Da PI: 8.9026

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PEQU_42224	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	42.8	1.2e-13	14	45	1	32
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32 +g+WT+eEd++l+d+++++G gtW+t ++ g PEQU_42224 14 KGPWTPEEDQKLIDYIQKHGHGTWRTLPKNAG 45 79************************999876 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	2.1E-15	5	43	IPR009057	Homeodomain-like
PROSITE profile	PS51294	14.389	9	49	IPR017930	Myb domain
SuperFamily	SSF46689	1.79E-10	9	43	IPR009057	Homeodomain-like
Pfam	PF00249	9.7E-11	14	45	IPR001005	SANT/Myb domain
CDD	cd00167	5.59E-7	16	45	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 49 aa Download sequence Send to blast
MGRVPCCDKN GLKKGPWTPE EDQKLIDYIQ KHGHGTWRTL PKNAGIHYC

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that may function in osmotic stress and wounding signaling pathways (Probable). Contributes to basal resistance against the herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269\|PubMed:19517001, ECO:0000305\|PubMed:12857823}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by light (PubMed:8980549). Induced by wounding, salt stress and abscisic acid (PubMed:12857823). Induced by the lepidopteran herbivore Pieris rapae (white cabbage butterfly) feeding (PubMed:19517001). {ECO:0000269\|PubMed:12857823, ECO:0000269\|PubMed:19517001, ECO:0000269\|PubMed:8980549}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020698110.1	6e-30	transcription factor MYB41-like
Swissprot	Q9LDR8	6e-26	MY102_ARATH; Transcription factor MYB102
TrEMBL	A0A2I0WRZ5	1e-28	A0A2I0WRZ5_9ASPA; Transcription factor MYB39
STRING	cassava4.1_010339m	2e-27	(Manihot esculenta)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G21440.1	3e-28	MYB-like 102

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Huang KC,Lin WC,Cheng WH Salt hypersensitive mutant 9, a nucleolar APUM23 protein, is essential for salt sensitivity in association with the ABA signaling pathway in Arabidopsis. BMC Plant Biol., 2018. 18(1): p. 40 [PMID:29490615] Zhu L,Guo J,Ma Z,Wang J,Zhou C Arabidopsis Transcription Factor MYB102 Increases Plant Susceptibility to Aphids by Substantial Activation of Ethylene Biosynthesis. Biomolecules, 2019. [PMID:29880735]