PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis

Family

NF-YB

Protein Properties

Length: 114aa MW: 12728.6 Da PI: 8.5981

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PEQU_41554	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	138.7	1.6e-43	16	106	4	94
NF-YB 4 qdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 qd +lPian++rimk++lP++akiskdak+t+qec+sefi+f+t+easdkc++e+r+t++g+d+++a+ lG+++y+ + k yl+kyre PEQU_41554 16 QDLLLPIANIGRIMKQALPTKAKISKDAKQTMQECASEFIAFITGEASDKCRKENRQTLSGEDICHAMKLLGLDKYACSAKSYLQKYREHC 106 899*************************************************************************************964 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	2.5E-42	10	110	IPR009072	Histone-fold
SuperFamily	SSF47113	3.42E-33	16	110	IPR009072	Histone-fold
Pfam	PF00808	6.3E-25	20	83	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	1.4E-12	47	65	No hit	No description
PRINTS	PR00615	1.4E-12	66	84	No hit	No description
PRINTS	PR00615	1.4E-12	85	103	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 114 aa Download sequence Send to blast
SNITTTAKDE GCRNVQDLLL PIANIGRIMK QALPTKAKIS KDAKQTMQEC ASEFIAFITG 60 EASDKCRKEN RQTLSGEDIC HAMKLLGLDK YACSAKSYLQ KYREHCEKSE AIKN

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	4e-35	16	104	4	92	Transcription factor HapC (Eurofung)
4g92_B	4e-35	16	104	4	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020595563.1	1e-79	transcriptional activator hap3-like isoform X1
Swissprot	O82248	6e-40	NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBL	A0A2I0XBB5	2e-51	A0A2I0XBB5_9ASPA; Nuclear transcription factor Y subunit B-5
STRING	Aquca_003_00805.1	7e-43	(Aquilegia coerulea)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP2917	38	87

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G47810.1	2e-42	nuclear factor Y, subunit B5

Publications ? help Back to Top
Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]