![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PEQU_40944 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 142aa MW: 16005.2 Da PI: 6.2533 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 137.7 | 3.3e-43 | 22 | 112 | 4 | 94 |
NF-YB 4 qdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 qd +lPian++rimk++lP++akiskdak+t+qec+sefi+f+t+easdkc++e+r+t++g+d+++a+ lG+++y+ + k yl+kyre PEQU_40944 22 QDLLLPIANIGRIMKQALPTKAKISKDAKQTMQECASEFIAFITGEASDKCRKENRQTLSGEDICHAMKLLGLDKYACSAKSYLQKYREHC 112 899*************************************************************************************964 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 9.0E-43 | 16 | 125 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.86E-33 | 22 | 120 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.1E-24 | 26 | 89 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 2.1E-12 | 53 | 71 | No hit | No description |
PRINTS | PR00615 | 2.1E-12 | 72 | 90 | No hit | No description |
PRINTS | PR00615 | 2.1E-12 | 91 | 109 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 142 aa Download sequence Send to blast |
MDENSDSNIT TTAKDEGCRN VQDLLLPIAN IGRIMKQALP TKAKISKDAK QTMQECASEF 60 IAFITGEASD KCRKENRQTL SGEDICHAMK LLGLDKYACS AKSYLQKYRE HCEKSEAIKN 120 TEPMETDMTD MLQIYCKSNQ HS |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 8e-35 | 22 | 110 | 4 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 8e-35 | 22 | 110 | 4 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020595563.1 | 1e-102 | transcriptional activator hap3-like isoform X1 | ||||
Swissprot | O82248 | 1e-39 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
TrEMBL | A0A2I0XBB5 | 3e-60 | A0A2I0XBB5_9ASPA; Nuclear transcription factor Y subunit B-5 | ||||
STRING | XP_008796244.1 | 2e-45 | (Phoenix dactylifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2917 | 38 | 87 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 5e-42 | nuclear factor Y, subunit B5 |
Publications ? help Back to Top | |||
---|---|---|---|
|