PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PEQU_40609

Organism

Phalaenopsis equestris

Taxonomic ID

78828

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis

Family

bZIP

Protein Properties

Length: 90aa MW: 9927.41 Da PI: 11.0501

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PEQU_40609	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	55.2	1.6e-17	30	76	2	48
XXXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 2 kelkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48 ++l+r++r++kNRe+A rsR+RK++++ +Le+ v +Le+eN L ke PEQU_40609 30 AALQRQKRMIKNRESAARSRERKQQYTNQLEQTVFKLEEENAILLKE 76 689***************************************99987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PRINTS	PR00041	7.4E-5	28	44	IPR001630	cAMP response element binding (CREB) protein
SMART	SM00338	3.0E-9	29	87	IPR004827	Basic-leucine zipper domain
Pfam	PF00170	2.9E-15	30	76	IPR004827	Basic-leucine zipper domain
PROSITE profile	PS50217	10.484	31	76	IPR004827	Basic-leucine zipper domain
SuperFamily	SSF57959	2.81E-12	33	77	No hit	No description
Gene3D	G3DSA:1.20.5.170	1.3E-15	34	78	No hit	No description
PROSITE pattern	PS00036	0	36	51	IPR004827	Basic-leucine zipper domain
PRINTS	PR00041	7.4E-5	46	66	IPR001630	cAMP response element binding (CREB) protein
PRINTS	PR00041	7.4E-5	66	83	IPR001630	cAMP response element binding (CREB) protein

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 90 aa Download sequence Send to blast
MAGMGDGAAA GGGERGKGRK RVAVDSADKA ALQRQKRMIK NRESAARSRE RKQQYTNQLE 60 QTVFKLEEEN AILLKERVPL SLSLSLSLVK

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	45	53	ARSRERKQQ

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to the ABA-responsive elements (ABREs) in vitro. Involved in abiotic stress responses and abscisic acid (ABA) signaling (PubMed:20039193). Involved in the signaling pathway that induces growth inhibition in response to D-allose (PubMed:23397192). {ECO:0000269\|PubMed:20039193, ECO:0000269\|PubMed:23397192}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by anoxia, drought, salt stress, oxidative stress, cold and abscisic acid (ABA) (PubMed:20039193). Induced by D-allose (PubMed:23397192). {ECO:0000269\|PubMed:20039193, ECO:0000269\|PubMed:23397192}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020587877.1	2e-46	G-box-binding factor 4-like isoform X1
Refseq	XP_020587878.1	2e-46	G-box-binding factor 4-like isoform X2
Swissprot	Q0JHF1	2e-20	BZP12_ORYSJ; bZIP transcription factor 12
TrEMBL	A0A2I0WAD0	6e-27	A0A2I0WAD0_9ASPA; G-box-binding factor 4
STRING	GSMUA_Achr3P22470_001	2e-20	(Musa acuminata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP2665	37	86

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G03970.1	1e-16	G-box binding factor 4

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764]