PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PEQU_40551

Organism

Phalaenopsis equestris

Taxonomic ID

78828

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis

Family

ARR-B

Protein Properties

Length: 194aa MW: 22471.8 Da PI: 6.5279

Description

ARR-B family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PEQU_40551	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	G2-like	61.6	1.5e-19	143	191	2	51
G2-like 2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 +r Wt+eLH+rF+++v+qL G +kA+P++i ++m + Lt+e v+ HLQ PEQU_40551 143 ARFTWTSELHARFIDVVNQL-GVKKAVPRKIFDMMTTPELTREIVANHLQ 191 799***************.*************************** PP
2	Response_reg	66.1	1.6e-22	1	84	26	108
EEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTESEEEESS--HHHHH CS Response_reg 26 vaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGakdflsKpfdpeelv 108 v+++d++++alell++++ +D++++D++m++mdG++ll+ ++e +lp+i+++ +e e +l+a+++Ga d+l+Kp+ eel PEQU_40551 1 VTVCDHARQALELLRANRdvYDIMITDVNMSEMDGFQLLEIVQNEI-NLPVIMISVDSEFEGVLKAINYGAVDYLVKPVRLEELK 84 6789********999999***************9887766.********************************9996 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF00072	2.7E-18	1	84	IPR001789	Signal transduction response regulator, receiver domain
SMART	SM00448	2.6E-5	1	87	IPR001789	Signal transduction response regulator, receiver domain
SuperFamily	SSF52172	1.99E-25	1	99	IPR011006	CheY-like superfamily
PROSITE profile	PS50110	32.551	1	91	IPR001789	Signal transduction response regulator, receiver domain
Gene3D	G3DSA:3.40.50.2300	3.9E-27	1	115	No hit	No description
CDD	cd00156	7.10E-21	1	95	No hit	No description
Gene3D	G3DSA:1.10.10.60	2.6E-18	139	191	IPR009057	Homeodomain-like
SuperFamily	SSF46689	2.87E-11	140	191	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	2.1E-16	143	192	IPR006447	Myb domain, plants

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0000160	Biological Process	phosphorelay signal transduction system
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 194 aa Download sequence Send to blast
VTVCDHARQA LELLRANRDV YDIMITDVNM SEMDGFQLLE IVQNEINLPV IMISVDSEFE 60 GVLKAINYGA VDYLVKPVRL EELKLIWRHA VKRYLNEKKD ANEIRSKDVQ ISELVKKSKY 120 RVRERNDDAN NDSEDGLPSQ KRARFTWTSE LHARFIDVVN QLGVKKAVPR KIFDMMTTPE 180 LTREIVANHL QVCS

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator that binds specifically to the DNA sequence 5'-[AG]GATT-3'. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. Could directly activate some type-A response regulators in response to cytokinins. Involved in the expression of nuclear genes for components of mitochondrial complex I. Promotes cytokinin-mediated leaf longevity. Involved in the ethylene signaling pathway in an ETR1-dependent manner and in the cytokinin signaling pathway. {ECO:0000269\|PubMed:11370868, ECO:0000269\|PubMed:11574878, ECO:0000269\|PubMed:15282545, ECO:0000269\|PubMed:16407152}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020597792.1	1e-121	two-component response regulator ARR10-like, partial
Swissprot	Q9ZWJ9	2e-50	ARR2_ARATH; Two-component response regulator ARR2
TrEMBL	A0A2I0W9B1	2e-64	A0A2I0W9B1_9ASPA; Two-component response regulator ARR10
STRING	GSMUA_Achr10P23650_001	3e-59	(Musa acuminata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP12043	4	6

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G16110.1	9e-53	response regulator 2

Publications ? help Back to Top
Takahashi N, et al. Cytokinins control endocycle onset by promoting the expression of an APC/C activator in Arabidopsis roots. Curr. Biol., 2013. 23(18): p. 1812-7 [PMID:24035544] Ge XM, et al. Heterotrimeric G protein mediates ethylene-induced stomatal closure via hydrogen peroxide synthesis in Arabidopsis. Plant J., 2015. 82(1): p. 138-50 [PMID:25704455] Takahashi N,Umeda M Cytokinins promote onset of endoreplication by controlling cell cycle machinery. Plant Signal Behav, 2014. 9(8): p. e29396 [PMID:25763620] Kobayashi K, et al. Shoot Removal Induces Chloroplast Development in Roots via Cytokinin Signaling. Plant Physiol., 2017. 173(4): p. 2340-2355 [PMID:28193764] Arnaud D, et al. Cytokinin-Mediated Regulation of Reactive Oxygen Species Homeostasis Modulates Stomatal Immunity in Arabidopsis. Plant Cell, 2017. 29(3): p. 543-559 [PMID:28254779] Zhang TQ, et al. A Two-Step Model for de Novo Activation of WUSCHEL during Plant Shoot Regeneration. Plant Cell, 2017. 29(5): p. 1073-1087 [PMID:28389585] Meng WJ, et al. Type-B ARABIDOPSIS RESPONSE REGULATORs Specify the Shoot Stem Cell Niche by Dual Regulation of WUSCHEL. Plant Cell, 2017. 29(6): p. 1357-1372 [PMID:28576846] Zhang F,May A,Irish VF Type-B ARABIDOPSIS RESPONSE REGULATORs Directly Activate WUSCHEL. Trends Plant Sci., 2017. 22(10): p. 815-817 [PMID:28886911] Takatsuka H,Higaki T,Umeda M Actin Reorganization Triggers Rapid Cell Elongation in Roots. Plant Physiol., 2018. 178(3): p. 1130-1141 [PMID:30185441]