PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PEQU_40031 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
Family | NF-YA | ||||||||
Protein Properties | Length: 178aa MW: 19889.9 Da PI: 10.5405 | ||||||||
Description | NF-YA family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | CBFB_NFYA | 102.8 | 3.1e-32 | 11 | 66 | 2 | 58 |
CBFB_NFYA 2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 p+YVNaKQ+++I++RR++Rak+e ++kl k rkpylheSRh hA+rRpRg+gGrF PEQU_40031 11 TPIYVNAKQFHGIIRRRKARAKAEMKNKL-VKIRKPYLHESRHLHAMRRPRGCGGRF 66 7****************************.**************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00521 | 4.2E-36 | 8 | 69 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE profile | PS51152 | 36.637 | 9 | 69 | IPR001289 | Nuclear transcription factor Y subunit A |
PRINTS | PR00616 | 4.1E-24 | 12 | 34 | IPR001289 | Nuclear transcription factor Y subunit A |
Pfam | PF02045 | 1.7E-28 | 12 | 66 | IPR001289 | Nuclear transcription factor Y subunit A |
PROSITE pattern | PS00686 | 0 | 14 | 34 | IPR018362 | CCAAT-binding factor, conserved site |
PRINTS | PR00616 | 4.1E-24 | 43 | 66 | IPR001289 | Nuclear transcription factor Y subunit A |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 178 aa Download sequence Send to blast |
MLLPLNMTAE TPIYVNAKQF HGIIRRRKAR AKAEMKNKLV KIRKPYLHES RHLHAMRRPR 60 GCGGRFLNTK KDADVQNVKS DNHNNGKHLT RPAITSPSSE ILQSDSGNLN SASCGSCISR 120 SEVTSMYSQG KNDHFHVIEH LRPSLYLPLA NMIVGDRSSV ILSKWGTSAD GCCDLLKV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_A | 5e-21 | 10 | 69 | 2 | 62 | HAPB protein |
4g92_A | 5e-21 | 10 | 69 | 2 | 62 | HAPB protein |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020575373.1 | 1e-129 | nuclear transcription factor Y subunit A-7-like isoform X2 | ||||
Refseq | XP_020595366.1 | 1e-132 | nuclear transcription factor Y subunit A-8-like | ||||
Swissprot | Q9LNP6 | 7e-31 | NFYA8_ARATH; Nuclear transcription factor Y subunit A-8 | ||||
TrEMBL | A0A2I0WD14 | 3e-99 | A0A2I0WD14_9ASPA; Nuclear transcription factor Y subunit A-10 | ||||
STRING | XP_008787766.1 | 8e-62 | (Phoenix dactylifera) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2307 | 37 | 90 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G17590.4 | 1e-27 | nuclear factor Y, subunit A8 |
Publications ? help Back to Top | |||
---|---|---|---|
|