PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis

Family

MYB_related

Protein Properties

Length: 116aa MW: 13551.6 Da PI: 8.9044

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PEQU_39245	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	32.2	2.5e-10	14	45	1	32
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32 rg W++eEde+l+++++ +G g+W+ ++ + g PEQU_39245 14 RGLWSPEEDEKLIKYITTHGYGCWSEVPDKAG 45 789************************99887 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	2.2E-23	6	89	IPR009057	Homeodomain-like
PROSITE profile	PS51294	16.394	9	90	IPR017930	Myb domain
SMART	SM00717	7.0E-8	13	88	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	2.12E-17	16	114	IPR009057	Homeodomain-like
Pfam	PF13921	1.9E-12	17	101	No hit	No description
CDD	cd00167	6.63E-8	17	86	No hit	No description
PROSITE profile	PS50090	3.961	87	116	IPR017877	Myb-like domain
Gene3D	G3DSA:1.10.10.60	7.9E-9	90	114	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 116 aa Download sequence Send to blast
MGHHSCCNQQ KVKRGLWSPE EDEKLIKYIT THGYGCWSEV PDKAGFYNCA FNSNWPQLVA 60 LLVINHIGCR LQRCGKSCRL RWINYLRPDI RRGRFSPEEE KLIISLHAVV GNRFDF

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that regulates lignified secondary cell wall thickening of the anther endocethium, which is necessary for anther dehiscence (PubMed:12753590, PubMed:17147638, PubMed:17329564). May play a role in specifying early endothecial cell development by regulating a number of genes linked to secondary thickening such as NST1 and NST2. Acts upstream of the lignin biosynthesis pathway (PubMed:17329564). {ECO:0000269\|PubMed:12753590, ECO:0000269\|PubMed:17147638, ECO:0000269\|PubMed:17329564}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Down-regulated by auxin. {ECO:0000269\|PubMed:23410518}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_013610297.1	6e-56	PREDICTED: transcription factor MYB23
Swissprot	Q9SPG3	3e-47	MYB26_ARATH; Transcription factor MYB26
TrEMBL	A0A0D3E407	1e-54	A0A0D3E407_BRAOL; Uncharacterized protein
STRING	Bo9g029530.1	2e-55	(Brassica oleracea)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP6032	37	57

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G63910.1	2e-55	myb domain protein 103

Publications ? help Back to Top
Coego A, et al. The TRANSPLANTA collection of Arabidopsis lines: a resource for functional analysis of transcription factors based on their conditional overexpression. Plant J., 2014. 77(6): p. 944-53 [PMID:24456507] Yang C, et al. Transcription Factor MYB26 Is Key to Spatial Specificity in Anther Secondary Thickening Formation. Plant Physiol., 2017. 175(1): p. 333-350 [PMID:28724622] Ghelli R, et al. A Newly Identified Flower-Specific Splice Variant of AUXIN RESPONSE FACTOR8 Regulates Stamen Elongation and Endothecium Lignification in Arabidopsis. Plant Cell, 2018. 30(3): p. 620-637 [PMID:29514943]