PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis

Family

Dof

Protein Properties

Length: 76aa MW: 8929.06 Da PI: 9.7563

Description

Dof family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PEQU_37410	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-Dof	84.9	7.7e-27	4	56	5	57
zf-Dof 5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrk 57 ++cprC+s++t+fCy+nny+++qPr++Ck C++yWt+GG+lr + +g+r+ PEQU_37410 4 RRACPRCHSRETRFCYFNNYNVNQPRHYCKLCHQYWTAGGTLRKLRRNAGSRR 56 679*****************************************999999987 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50884	23.365	5	59	IPR003851	Zinc finger, Dof-type
Pfam	PF02701	1.1E-23	5	56	IPR003851	Zinc finger, Dof-type
ProDom	PD007478	6.0E-17	6	56	IPR003851	Zinc finger, Dof-type

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 76 aa Download sequence Send to blast
ARTRRACPRC HSRETRFCYF NNYNVNQPRH YCKLCHQYWT AGGTLRKLRR NAGSRRCLFA 60 GVMQDSSSHE ECSGEV

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Transcriptional repressor of 'CONSTANS' expression (By similarity). Regulates a photoperiodic flowering response. {ECO:0000250, ECO:0000269\|PubMed:19619493}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269\|PubMed:19619493}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020694660.1	2e-23	cyclic dof factor 4-like
Refseq	XP_026429024.1	2e-23	cyclic dof factor 4-like
Swissprot	O22967	9e-23	CDF4_ARATH; Cyclic dof factor 4
TrEMBL	A0A2I0X2Q1	4e-22	A0A2I0X2Q1_9ASPA; Cyclic dof factor 4
STRING	XP_008813764.1	8e-22	(Phoenix dactylifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP6495	28	51

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G34140.1	4e-25	Dof family protein

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Bueso E, et al. Arabidopsis COGWHEEL1 links light perception and gibberellins with seed tolerance to deterioration. Plant J., 2016. 87(6): p. 583-96 [PMID:27227784]