 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
PEQU_34075 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
Family |
MYB_related |
Protein Properties |
Length: 88aa MW: 10107.7 Da PI: 9.7213 |
Description |
MYB_related family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
PEQU_34075 | genome | BGI | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | Myb_DNA-binding | 56.4 | 7e-18 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+grWT eEde+lv+++++ G g+W++ ++ g+ R++k+c++rw +yl
PEQU_34075 14 KGRWTMEEDEILVNYIAENGEGSWRSLPKNAGLLRCGKSCRLRWINYL 61
79******************************99************97 PP
|
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Transcription factor postulated to regulate the biosynthetic pathway of a flavonoid-derived pigment in certain floral tissues. |
Publications
? help Back to Top |
- Robbins ML,Sekhon RS,Meeley R,Chopra S
A Mutator transposon insertion is associated with ectopic expression of a tandemly repeated multicopy Myb gene pericarp color1 of maize. Genetics, 2008. 178(4): p. 1859-74 [PMID:18430921] - Sidorenko L,Chandler V
RNA-dependent RNA polymerase is required for enhancer-mediated transcriptional silencing associated with paramutation at the maize p1 gene. Genetics, 2008. 180(4): p. 1983-93 [PMID:18845841] - Robbins ML,Wang P,Sekhon RS,Chopra S
Gene structure induced epigenetic modifications of pericarp color1 alleles of maize result in tissue-specific mosaicism. PLoS ONE, 2009. 4(12): p. e8231 [PMID:20011605] - Rhee Y,Sekhon RS,Chopra S,Kaeppler S
Tissue culture-induced novel epialleles of a Myb transcription factor encoded by pericarp color1 in maize. Genetics, 2010. 186(3): p. 843-55 [PMID:20823340] - Morohashi K, et al.
A genome-wide regulatory framework identifies maize pericarp color1 controlled genes. Plant Cell, 2012. 24(7): p. 2745-64 [PMID:22822204]
|