PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

PEQU_32107

Organism

Phalaenopsis equestris

Taxonomic ID

78828

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis

Family

WRKY

Protein Properties

Length: 109aa MW: 12632.2 Da PI: 9.8386

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PEQU_32107	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	99.9	1.6e-31	25	83	1	59
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDg++WrKYG+K vk+s++pr+YYrC+s+gC+vkk+ver+++d ++v+++Yeg+Hnh PEQU_32107 25 LDDGFKWRKYGKKAVKNSPNPRNYYRCSSTGCEVKKRVERDRSDSNYVITIYEGTHNHM 83 59********************************************************6 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	9.9E-33	14	85	IPR003657	WRKY domain
SuperFamily	SSF118290	7.98E-28	17	85	IPR003657	WRKY domain
PROSITE profile	PS50811	30.905	20	85	IPR003657	WRKY domain
SMART	SM00774	2.2E-34	25	84	IPR003657	WRKY domain
Pfam	PF03106	6.4E-25	26	82	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 109 aa Download sequence Send to blast
EEVKRRKAEA GCRIGFRTKS EVEVLDDGFK WRKYGKKAVK NSPNPRNYYR CSSTGCEVKK 60 RVERDRSDSN YVITIYEGTH NHMSPDCRPY TTDFPQPAIS SHSFLKPTP

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1wj2_A	2e-25	15	85	7	77	Probable WRKY transcription factor 4
2lex_A	2e-25	15	85	7	77	Probable WRKY transcription factor 4
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020592170.1	3e-77	probable WRKY transcription factor 75
Swissprot	Q8VWQ5	5e-36	WRK50_ARATH; Probable WRKY transcription factor 50
TrEMBL	A0A2I0X6S6	5e-61	A0A2I0X6S6_9ASPA; Putative WRKY transcription factor 50
STRING	XP_008812299.1	8e-46	(Phoenix dactylifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP441	37	206

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G26170.1	2e-38	WRKY DNA-binding protein 50

Publications ? help Back to Top
Brand LH,Kirchler T,Hummel S,Chaban C,Wanke D DPI-ELISA: a fast and versatile method to specify the binding of plant transcription factors to DNA in vitro. Plant Methods, 2010. 6: p. 25 [PMID:21108821]