PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis

Family

MYB

Protein Properties

Length: 122aa MW: 14143 Da PI: 9.6065

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PEQU_31880	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	31.1	5.6e-10	14	44	1	31
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartm 31 rg W++eEde+l+++++ +G g+W+ ++ + PEQU_31880 14 RGLWSPEEDEKLIKYITTHGYGCWSEVPDKA 44 789************************9875 PP
2	Myb_DNA-binding	30.9	6.5e-10	83	106	23	47
-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 23 tWktIartmgkgRtlkqcksrwqky 47 +W+ Ia++++ gRt++++k++w+++ PEQU_31880 83 RWAHIASHLP-GRTDNEIKNYWNSW 106 5*******.**********98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	5.4E-11	9	44	IPR009057	Homeodomain-like
PROSITE profile	PS50090	9.442	9	107	IPR017877	Myb-like domain
SMART	SM00717	2.2E-13	13	109	IPR001005	SANT/Myb domain
Pfam	PF00249	1.9E-7	14	43	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	9.77E-14	14	108	IPR009057	Homeodomain-like
CDD	cd00167	4.67E-8	17	107	No hit	No description
Gene3D	G3DSA:1.10.10.60	1.9E-17	81	113	IPR009057	Homeodomain-like
Pfam	PF00249	7.9E-8	83	106	IPR001005	SANT/Myb domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 122 aa Download sequence Send to blast
MGHHSCCNQQ KVKRGLWSPE EDEKLIKYIT THGYGCWSEV PDKADGGAPL WSAAIWDRSY 60 HGNFDTRLFT TPYLRYVVIL YLRWAHIASH LPGRTDNEIK NYWNSWIKKK IRKPSTGTSS 120 SS

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that regulates lignified secondary cell wall thickening of the anther endocethium, which is necessary for anther dehiscence (PubMed:12753590, PubMed:17147638, PubMed:17329564). May play a role in specifying early endothecial cell development by regulating a number of genes linked to secondary thickening such as NST1 and NST2. Acts upstream of the lignin biosynthesis pathway (PubMed:17329564). {ECO:0000269\|PubMed:12753590, ECO:0000269\|PubMed:17147638, ECO:0000269\|PubMed:17329564}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Down-regulated by auxin. {ECO:0000269\|PubMed:23410518}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020701551.1	8e-50	transcription factor MYB13
Swissprot	Q9SPG3	4e-32	MYB26_ARATH; Transcription factor MYB26
TrEMBL	A0A498I7I8	3e-46	A0A498I7I8_MALDO; Uncharacterized protein
STRING	XP_008360686.1	4e-47	(Malus domestica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP6032	37	57

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G63910.1	1e-47	myb domain protein 103

Publications ? help Back to Top
Coego A, et al. The TRANSPLANTA collection of Arabidopsis lines: a resource for functional analysis of transcription factors based on their conditional overexpression. Plant J., 2014. 77(6): p. 944-53 [PMID:24456507] Yang C, et al. Transcription Factor MYB26 Is Key to Spatial Specificity in Anther Secondary Thickening Formation. Plant Physiol., 2017. 175(1): p. 333-350 [PMID:28724622] Ghelli R, et al. A Newly Identified Flower-Specific Splice Variant of AUXIN RESPONSE FACTOR8 Regulates Stamen Elongation and Endothecium Lignification in Arabidopsis. Plant Cell, 2018. 30(3): p. 620-637 [PMID:29514943]