PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis

Family

HD-ZIP

Protein Properties

Length: 200aa MW: 23238.6 Da PI: 7.6355

Description

HD-ZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PEQU_30359	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	60.7	2.2e-19	69	123	2	56
T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS Homeobox 2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 rk+ ++++eq ++Le+ F+ +++++ ++eeLAkklgL rqV vWFqNrRa+ k PEQU_30359 69 RKKLRLNPEQSNILEDSFRASNTLTSLQKEELAKKLGLLPRQVEVWFQNRRARTK 123 678899***********************************************98 PP
2	HD-ZIP_I/II	116.8	1.3e-37	69	156	1	88
HD-ZIP_I/II 1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 +kk+rl+ eq+++LE+sF+++++L++ +K+ela++Lgl prqv+vWFqnrRARtk+kq+E+d+e+L++++++l+een+rL++ev+eLr PEQU_30359 69 RKKLRLNPEQSNILEDSFRASNTLTSLQKEELAKKLGLLPRQVEVWFQNRRARTKLKQTEVDCEVLRTWCENLREENRRLRREVQELR 156 69************************************************************************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	1.3E-18	50	123	IPR009057	Homeodomain-like
SuperFamily	SSF46689	3.05E-18	58	126	IPR009057	Homeodomain-like
PROSITE profile	PS50071	17.248	65	125	IPR001356	Homeobox domain
SMART	SM00389	1.7E-17	67	129	IPR001356	Homeobox domain
Pfam	PF00046	1.9E-16	69	123	IPR001356	Homeobox domain
CDD	cd00086	2.15E-15	69	126	No hit	No description
PRINTS	PR00031	7.7E-7	96	105	IPR000047	Helix-turn-helix motif
PROSITE pattern	PS00027	0	100	123	IPR017970	Homeobox, conserved site
PRINTS	PR00031	7.7E-7	105	121	IPR000047	Helix-turn-helix motif
SMART	SM00340	1.6E-12	125	168	IPR003106	Leucine zipper, homeobox-associated
Pfam	PF02183	1.8E-10	125	156	IPR003106	Leucine zipper, homeobox-associated

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 200 aa Download sequence Send to blast
MGEDICDTTL GLAIGEGRRC EPEPTVRLQL WFPSYPKEEI KEEDEEKRLP MATKSKSCED 60 EDDNKHGTRK KLRLNPEQSN ILEDSFRASN TLTSLQKEEL AKKLGLLPRQ VEVWFQNRRA 120 RTKLKQTEVD CEVLRTWCEN LREENRRLRR EVQELRFYAE VSKVEGIRVC PSCEGLMAVE 180 EKGGGFVLGK KRPRVLQLCS

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	67	73	TRKKLRL
2	117	125	RRARTKLKQ

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor involved in the negative regulation of cell elongation and specific cell proliferation processes such as lateral root formation and secondary growth of the vascular system. Acts as mediator of the red/far-red light effects on leaf cell expansion in the shading response. Binds to the DNA sequence 5'-CAAT[GC]ATTG-3'. Negatively regulates its own expression. {ECO:0000269\|PubMed:10477292, ECO:0000269\|PubMed:11260495, ECO:0000269\|PubMed:8449400}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Rapidly and strongly induced by lowering the ratio of red to far-red light. {ECO:0000269\|PubMed:8106086}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020695121.1	2e-98	homeobox-leucine zipper protein HOX15-like
Swissprot	Q05466	1e-39	HAT4_ARATH; Homeobox-leucine zipper protein HAT4
TrEMBL	A0A2I0X1N6	2e-96	A0A2I0X1N6_9ASPA; Homeobox-leucine zipper protein HOX7
STRING	XP_008789723.1	7e-46	(Phoenix dactylifera)
STRING	GSMUA_Achr2P04490_001	3e-46	(Musa acuminata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP8315	32	49

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G06710.1	2e-29	homeobox from Arabidopsis thaliana

Publications ? help Back to Top
Carabelli M,Turchi L,Ruzza V,Morelli G,Ruberti I Homeodomain-Leucine Zipper II family of transcription factors to the limelight: central regulators of plant development. Plant Signal Behav, 2014. [PMID:23838958] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Francisco M, et al. Genome Wide Association Mapping in Arabidopsis thaliana Identifies Novel Genes Involved in Linking Allyl Glucosinolate to Altered Biomass and Defense. Front Plant Sci, 2016. 7: p. 1010 [PMID:27462337] Müller-Moulé P, et al. YUCCA auxin biosynthetic genes are required for Arabidopsis shade avoidance. PeerJ, 2016. 4: p. e2574 [PMID:27761349] Ivarson E, et al. Effects of Overexpression of WRI1 and Hemoglobin Genes on the Seed Oil Content of Lepidium campestre. Front Plant Sci, 2016. 7: p. 2032 [PMID:28119714] Kasulin L, et al. A single haplotype hyposensitive to light and requiring strong vernalization dominates Arabidopsis thaliana populations in Patagonia, Argentina. Mol. Ecol., 2017. 26(13): p. 3389-3404 [PMID:28316114] Singh M,Gupta A,Singh D,Khurana JP,Laxmi A Arabidopsis RSS1 Mediates Cross-Talk Between Glucose and Light Signaling During Hypocotyl Elongation Growth. Sci Rep, 2017. 7(1): p. 16101 [PMID:29170398]