![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | PEQU_22909 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
||||||||
Family | ERF | ||||||||
Protein Properties | Length: 105aa MW: 11240 Da PI: 4.2076 | ||||||||
Description | ERF family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | AP2 | 48.9 | 1.6e-15 | 3 | 44 | 12 | 55 |
AP2 12 rgrWvAeIrdpsengkrkrfslgkfgtaeeAakaaiaarkkleg 55 +g++vAeIrd s++g r +lg+f+taeeAa+a+++a+ +l+g PEQU_22909 3 WGKFVAEIRD-STRG-GVRLWLGTFDTAEEAARAYDRAAAALRG 44 9*********.3433.4*************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51032 | 18.373 | 1 | 52 | IPR001471 | AP2/ERF domain |
SuperFamily | SSF54171 | 1.44E-18 | 2 | 53 | IPR016177 | DNA-binding domain |
SMART | SM00380 | 9.1E-24 | 2 | 58 | IPR001471 | AP2/ERF domain |
Gene3D | G3DSA:3.30.730.10 | 5.1E-24 | 3 | 52 | IPR001471 | AP2/ERF domain |
Pfam | PF00847 | 1.5E-9 | 3 | 44 | IPR001471 | AP2/ERF domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 105 aa Download sequence Send to blast |
XXWGKFVAEI RDSTRGGVRL WLGTFDTAEE AARAYDRAAA ALRGQLAILN FPGEVPISAT 60 TGITTSTATG SSETASRPEA GRGEQVIELE CLDDKLLEDL LYVGE |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5wx9_A | 4e-25 | 3 | 96 | 23 | 114 | Ethylene-responsive transcription factor ERF096 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probably acts as a transcriptional activator. Binds to the GCC-box pathogenesis-related promoter element. May be involved in the regulation of gene expression by stress factors and by components of stress signal transduction pathways (By similarity). {ECO:0000250}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020580450.1 | 4e-61 | ethylene-responsive transcription factor ERF096-like | ||||
Swissprot | Q9LTC5 | 1e-27 | ERF98_ARATH; Ethylene-responsive transcription factor ERF098 | ||||
TrEMBL | A0A2I0X699 | 3e-37 | A0A2I0X699_9ASPA; Ethylene-responsive transcription factor ERF098 | ||||
STRING | XP_010039174.1 | 2e-32 | (Eucalyptus grandis) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP277 | 37 | 249 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G23230.1 | 6e-16 | ERF family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|