 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
PEQU_12926 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis
|
| Family |
WOX |
| Protein Properties |
Length: 104aa MW: 12303.1 Da PI: 11.0063 |
| Description |
WOX family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| PEQU_12926 | genome | BGI | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | Homeobox | 42.8 | 9.1e-14 | 3 | 47 | 18 | 57 |
HHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
Homeobox 18 lFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
lF r+ps+e++++++ +l +++ ++V++WFqN++a+e++
PEQU_12926 3 LFSAgLRTPSTEQIQKISYHLssfgKIENKNVFYWFQNHKARERH 47
6776689************************************95 PP
|
| 2 | Wus_type_Homeobox | 80.6 | 1.9e-26 | 2 | 48 | 18 | 64 |
Wus_type_Homeobox 18 elyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
+l+++GlrtP++e+iq+i+ +L+++Gkie+kNVfyWFQN+kaRer++
PEQU_12926 2 DLFSAGLRTPSTEQIQKISYHLSSFGKIENKNVFYWFQNHKARERHH 48
69*******************************************97 PP
|
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Transcription factor which may be involved in the specification and maintenance of the stem cells (QC cells) in the root apical meristem (RAM). {ECO:0000269|PubMed:12904206}. |
| Publications
? help Back to Top |
- Kikuchi S, et al.
Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
Science, 2003. 301(5631): p. 376-9
[PMID:12869764] - Li S, et al.
OsFIE2 plays an essential role in the regulation of rice vegetative and reproductive development.
New Phytol., 2014. 201(1): p. 66-79
[PMID:24020752] - Chu H, et al.
A CLE-WOX signalling module regulates root meristem maintenance and vascular tissue development in rice.
J. Exp. Bot., 2013. 64(17): p. 5359-69
[PMID:24043854] - Wang W, et al.
Dwarf Tiller1, a Wuschel-related homeobox transcription factor, is required for tiller growth in rice.
PLoS Genet., 2014. 10(3): p. e1004154
[PMID:24625559] - Coudert Y, et al.
Identification of CROWN ROOTLESS1-regulated genes in rice reveals specific and conserved elements of postembryonic root formation.
New Phytol., 2015. 206(1): p. 243-54
[PMID:25442012]
|
