PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Protein Features |

Gene Ontology |

Function |

Regulation |

Orthologous Group |

Basic Information? help Back to Top

TF ID

PEQU_12386

Organism

Phalaenopsis equestris

Taxonomic ID

78828

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis

Family

G2-like

Protein Properties

Length: 62aa MW: 7272.41 Da PI: 9.88

Description

G2-like family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PEQU_12386	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	G2-like	46.3	9.6e-15	18	49	25	56
G2-like 25 ekAtPktilelmkvkgLtlehvkSHLQkYRla 56 ++A+Pkti +lm+v+gLt+e+v S LQkYRl+ PEQU_12386 18 KNAVPKTIIQLMNVDGLTRENVVSQLQKYRLY 49 79****************************85 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF46689	1.02E-7	16	52	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	2.3E-14	16	53	IPR009057	Homeodomain-like
TIGRFAMs	TIGR01557	4.0E-10	18	48	IPR006447	Myb domain, plants

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 62 aa Download sequence Send to blast
MQGLFDETTE ISARTQYKNA VPKTIIQLMN VDGLTRENVV SQLQKYRLYV KRYKDSVNHL 60 LI

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that is essential for the generation of the circadian clock oscillation. Binds to specific sites on CCA1 promoter leading to CCA1 activation (By similarity). {ECO:0000250}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Circadian oscillation with peaks at subjective dusk. {ECO:0000269\|PubMed:16164597}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_023732561.1	8e-15	transcription factor PCL1-like
Refseq	XP_023732562.1	8e-15	transcription factor PCL1-like
Swissprot	Q94DH3	7e-16	PCL1_ORYSJ; Transcription factor PCL1

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP1620	34	105

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G46640.2	1e-16	G2-like family protein