PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; Asparagales; Orchidaceae; Epidendroideae; Vandeae; Aeridinae; Phalaenopsis

Family

NF-YB

Protein Properties

Length: 188aa MW: 20040.3 Da PI: 6.2704

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
PEQU_11449	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	182.6	3.3e-57	26	121	2	97
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 reqdr+lPianvsrimkk+lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfedy+eplkvyl+k+releg+k PEQU_11449 26 REQDRLLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEDYAEPLKVYLQKFRELEGDK 121 89********************************************************************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	1.8E-54	21	132	IPR009072	Histone-fold
SuperFamily	SSF47113	1.55E-40	28	132	IPR009072	Histone-fold
Pfam	PF00808	1.1E-27	31	95	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	1.9E-21	59	77	No hit	No description
PROSITE pattern	PS00685	0	62	78	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	1.9E-21	78	96	No hit	No description
PRINTS	PR00615	1.9E-21	97	115	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 188 aa Download sequence Send to blast
MADSDNESAG NNNSGGATNS DFSSPREQDR LLPIANVSRI MKKALPANAK ISKDAKETVQ 60 ECVSEFISFI TGEASDKCQR EKRKTINGDD LLWAMTTLGF EDYAEPLKVY LQKFRELEGD 120 KGISSAQSQQ KEEFAGGGML MMGRQMYGST YHPQHHNMGG KGGGLGSGGG NSSAGAGIGR 180 GKGGYDLC

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	3e-48	26	116	2	92	Transcription factor HapC (Eurofung)
4g92_B	3e-48	26	116	2	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020591112.1	1e-138	nuclear transcription factor Y subunit B-3-like
Swissprot	O23310	7e-70	NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBL	A0A2I0X813	5e-97	A0A2I0X813_9ASPA; Nuclear transcription factor Y subunit B-3
STRING	XP_008790319.1	8e-76	(Phoenix dactylifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP201	38	331

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G14540.1	7e-67	nuclear factor Y, subunit B3

Publications ? help Back to Top
Han X, et al. Overexpression of the poplar NF-YB7 transcription factor confers drought tolerance and improves water-use efficiency in Arabidopsis. J. Exp. Bot., 2013. 64(14): p. 4589-601 [PMID:24006421] Hwang YH, et al. Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] Hossain MA, et al. Identification of Novel Components of the Unfolded Protein Response in Arabidopsis. Front Plant Sci, 2016. 7: p. 650 [PMID:27242851] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]